Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human
Product name | ABflo® 647 Rabbit anti-Human CD40 mAb |
---|---|
Catalog No. | A21947 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | R19022M7A33F6-ABf647 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-193 of human CD40 (P25942). |
---|---|
Sequence | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
Gene ID | 958 |
Swiss prot | P25942 |
Synonyms | p50; Bp50; CDW40; TNFRSF5 |
Calculated MW | 31kDa |
Observed MW | Refer to figures |
Reactivity | Human |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Application key | Flow Cytometry |
Positive samples | |
Cellular location | Cell membrane, Single-pass type I membrane protein, Secreted |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A21947 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on CD40. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to CD40. (Distance between topics and target gene indicate popularity.) CD40
* Data provided by citexs.com, for reference only.
Publishing research using A21947? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.