Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

ABflo® 647 Rabbit anti-Human CD40 mAb (A21947)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD40 mAb (A21947)

Flow cytometry:1X10^6 Jurkat cells (negative control, left) and Raji cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD40 mAb(A21947, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

You may also interested in:

Overview

Product name ABflo® 647 Rabbit anti-Human CD40 mAb
Catalog No. A21947
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. R19022M7A33F6-ABf647

Background

This gene is a member of the TNF-receptor superfamily. The encoded protein is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Mutations affecting this gene are the cause of autosomal recessive hyper-IgM immunodeficiency type 3 (HIGM3). Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-193 of human CD40 (P25942).
Sequence EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Gene ID 958
Swiss prot P25942
Synonyms p50; Bp50; CDW40; TNFRSF5
Calculated MW 31kDa
Observed MW Refer to figures

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at 2-8℃. Avoid freeze.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Application key Flow Cytometry    
Positive samples
Cellular location Cell membrane, Single-pass type I membrane protein, Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 647 Rabbit anti-Human CD40 mAb images

ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD40 mAb (A21947)}

Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD40 mAb (A21947)

Flow cytometry:1X10^6 Jurkat cells (negative control, left) and Raji cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD40 mAb(A21947, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Inquire About This Product

Submit your question about A21947 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD40. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD40. (Distance between topics and target gene indicate popularity.) CD40

* Data provided by citexs.com, for reference only.

Publishing research using A21947? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

Proteins (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order