Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

14-3-3 gamma Rabbit pAb (A3043)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - 14-3-3 gamma Rabbit pAb (A3043)

Western blot analysis of various lysates using 14-3-3 gamma Rabbit pAb (A3043) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 1s.

ABclonal:Immunohistochemistry - 14-3-3 gamma Rabbit pAb (A3043)

Immunohistochemistry analysis of 14-3-3 gamma in paraffin-embedded Human colon using 14-3-3 gamma Rabbit pAb (A3043) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - 14-3-3 gamma Rabbit pAb (A3043)

Immunohistochemistry analysis of 14-3-3 gamma in paraffin-embedded Rat spleen using 14-3-3 gamma Rabbit pAb (A3043) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name 14-3-3 gamma Rabbit pAb
Catalog No. A3043
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 gamma (NP_036611.2).
Sequence VLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA
Gene ID 7532
Swiss prot P61981
Synonyms DEE56; EIEE56; PPP1R170; 14-3-3GAMMA; 14-3-3 gamma
Calculated MW 28kDa
Observed MW 28kDa/

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples U-251MG, K-562, HeLa, Mouse brain, Mouse heart, HeLa, Mouse heart, Rat brain
Cellular location Cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

14-3-3 gamma Rabbit pAb images

ABclonal:Western blot - 14-3-3 gamma Rabbit pAb (A3043)}

Western blot - 14-3-3 gamma Rabbit pAb (A3043)

Western blot analysis of various lysates using 14-3-3 gamma Rabbit pAb (A3043) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 1s.
ABclonal:Immunohistochemistry - 14-3-3 gamma Rabbit pAb (A3043)}

Immunohistochemistry - 14-3-3 gamma Rabbit pAb (A3043)

Immunohistochemistry analysis of 14-3-3 gamma in paraffin-embedded Human colon using 14-3-3 gamma Rabbit pAb (A3043) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - 14-3-3 gamma Rabbit pAb (A3043)}

Immunohistochemistry - 14-3-3 gamma Rabbit pAb (A3043)

Immunohistochemistry analysis of 14-3-3 gamma in paraffin-embedded Rat spleen using 14-3-3 gamma Rabbit pAb (A3043) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A3043 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on YWHAG. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to YWHAG. (Distance between topics and target gene indicate popularity.) YWHAG

* Data provided by citexs.com, for reference only.

Publishing research using A3043? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order