Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)

Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)

Western blot analysis of various lysates using Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)

Immunohistochemistry analysis of Thioredoxin reductase 1 (TXNRD1 ) in paraffin-embedded human placenta using Thioredoxin reductase 1 (Thioredoxin reductase 1 (TXNRD1 ) ) antibody (A16631) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)

Immunohistochemistry analysis of Thioredoxin reductase 1 (TXNRD1 ) in paraffin-embedded mouse testis using Thioredoxin reductase 1 (Thioredoxin reductase 1 (TXNRD1 ) ) antibody (A16631) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)

Immunofluorescence analysis of C6 cells using Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)

Immunofluorescence analysis of L929 cells using Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)

Immunofluorescence analysis of U-2 OS cells using Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb
Catalog No. A16631
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing flavoenzymes, which reduce thioredoxins, as well as other substrates, and play a key role in redox homoeostasis. This gene encodes an ubiquitously expressed, cytosolic form of TrxR, which functions as a homodimer containing FAD, and selenocysteine (Sec) at the active site. Sec is encoded by UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternative splicing, primarily at the 5' end, results in transcript variants encoding same or different isoforms, including a glutaredoxin-containing isoform that is predominantly expressed in testis.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 410-490 of human Thioredoxin reductase 1 (TXNRD1) (NP_001087240.1).
Sequence EAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKV
Gene ID 7296
Swiss prot Q16881
Synonyms TR; TR1; TXNR; TRXR1; GRIM-12; Thioredoxin reductase 1 (TXNRD1 )
Calculated MW 71kDa
Observed MW 65kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:100
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HepG2, BxPC-3, Mouse heart
Cellular location cytosol, extracellular exosome, fibrillar center, mitochondrion, nucleoplasm
Customer validation

WB (Gallus gallus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb images

ABclonal:Western blot - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)}

Western blot - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)

Western blot analysis of various lysates using Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)}

Immunohistochemistry - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)

Immunohistochemistry analysis of Thioredoxin reductase 1 (TXNRD1 ) in paraffin-embedded human placenta using Thioredoxin reductase 1 (Thioredoxin reductase 1 (TXNRD1 ) ) antibody (A16631) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)}

Immunohistochemistry - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)

Immunohistochemistry analysis of Thioredoxin reductase 1 (TXNRD1 ) in paraffin-embedded mouse testis using Thioredoxin reductase 1 (Thioredoxin reductase 1 (TXNRD1 ) ) antibody (A16631) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)}

Immunofluorescence - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)

Immunofluorescence analysis of C6 cells using Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)}

Immunofluorescence - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)

Immunofluorescence analysis of L929 cells using Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)}

Immunofluorescence - Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631)

Immunofluorescence analysis of U-2 OS cells using Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A16631 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TXNRD1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TXNRD1. (Distance between topics and target gene indicate popularity.) TXNRD1

* Data provided by citexs.com, for reference only.

Publishing research using A16631? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order