Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TXNDC9 Rabbit pAb (A9676)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TXNDC9 Rabbit pAb (A9676)

Western blot analysis of various lysates using TXNDC9 Rabbit pAb (A9676) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - TXNDC9 Rabbit pAb (A9676)

Immunohistochemistry analysis of TXNDC9 in paraffin-embedded Human colon carcinoma using TXNDC9 Rabbit pAb (A9676) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name TXNDC9 Rabbit pAb
Catalog No. A9676
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the thioredoxin family. The exact function of this protein is not known but it is associated with cell differentiation.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TXNDC9 (NP_005774.2).
Sequence MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRH
Gene ID 10190
Swiss prot O14530
Synonyms APACD; PHLP3; TXNDC9
Calculated MW 27kDa
Observed MW 26kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples U-87MG, 293T, HeLa, Jurkat, Mouse testis, Mouse heart
Cellular location Cytoplasm, Midbody, Nucleus, centrosome, cytoskeleton, microtubule organizing center

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TXNDC9 Rabbit pAb images

ABclonal:Western blot - TXNDC9 Rabbit pAb (A9676)}

Western blot - TXNDC9 Rabbit pAb (A9676)

Western blot analysis of various lysates using TXNDC9 Rabbit pAb (A9676) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - TXNDC9 Rabbit pAb (A9676)}

Immunohistochemistry - TXNDC9 Rabbit pAb (A9676)

Immunohistochemistry analysis of TXNDC9 in paraffin-embedded Human colon carcinoma using TXNDC9 Rabbit pAb (A9676) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A9676 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TXNDC9. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TXNDC9. (Distance between topics and target gene indicate popularity.) TXNDC9

* Data provided by citexs.com, for reference only.

Publishing research using A9676? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order