Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TMPRSS11A Rabbit pAb (A8605)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TMPRSS11A Rabbit pAb (A8605)

Western blot analysis of extracts of various cell lines, using TMPRSS11A antibody (A8605) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

You may also interested in:

Overview

Product name TMPRSS11A Rabbit pAb
Catalog No. A8605
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable serine-type endopeptidase activity. Predicted to be involved in proteolysis. Predicted to be located in extracellular region. Predicted to be integral component of plasma membrane.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-421 of human TMPRSS11A (NP_872412.3).
Sequence SASFQPNLTVHITGFGALYYGGESQNDLREARVKIISDDVCKQPQVYGNDIKPGMFCAGYMEGIYDACRGDSGGPLVTRDLKDTWYLIGIVSWGDNCGQKDKPGVYTQVTYYRNWIASKTGI
Gene ID 339967
Swiss prot Q6ZMR5
Synonyms HESP; ECRG1; HATL1; TMPRSS11A
Calculated MW 47kDa
Observed MW 48kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, A-549, SW620, Mouse liver, Rat liver
Cellular location Membrane, Single-pass type II membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

TMPRSS11A Rabbit pAb images

ABclonal:Western blot - TMPRSS11A Rabbit pAb (A8605)}

Western blot - TMPRSS11A Rabbit pAb (A8605)

Western blot analysis of extracts of various cell lines, using TMPRSS11A antibody (A8605) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

Inquire About This Product

Submit your question about A8605 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TMPRSS11A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TMPRSS11A. (Distance between topics and target gene indicate popularity.) TMPRSS11A

* Data provided by citexs.com, for reference only.

Publishing research using A8605? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order