Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TJP2 Rabbit pAb (A0594)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - TJP2 Rabbit pAb (A0594)

Western blot analysis of lysates from HeLa cells, using TJP2 Rabbit pAb (A0594) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunoprecipitation - TJP2 Rabbit pAb (A0594)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg TJP2 antibody (A0594). Western blot was performed from the immunoprecipitate using TJP2 antibody (A0594) at a dilution of 1:1000.

You may also interested in:

Overview

Product name TJP2 Rabbit pAb
Catalog No. A0594
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a zonula occluden that is a member of the membrane-associated guanylate kinase homolog family. The encoded protein functions as a component of the tight junction barrier in epithelial and endothelial cells and is necessary for proper assembly of tight junctions. Mutations in this gene have been identified in patients with hypercholanemia, and genomic duplication of a 270 kb region including this gene causes autosomal dominant deafness-51. Alternatively spliced transcripts encoding multiple isoforms have been observed for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 951-1190 of human TJP2 (NP_004808.2).
Sequence RSSEPVQHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPTFGRSILKPSTPIPPQEGEEVGESSEEQDNAPKSVLGKVKIFEKMDHKARLQRMQELQEAQNARIEIAQKHPDIYAVPIKTHKPDPGTPQHTSSRPPEPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTEL
Gene ID 9414
Swiss prot Q9UDY2
Synonyms ZO2; X104; FHCA1; PFIC4; DFNA51; DUP9q21.11; C9DUPq21.11; TJP2
Calculated MW 134kDa
Observed MW 160kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples HeLa
Cellular location Cell junction, Cell membrane, Cytoplasmic side, Nucleus, Peripheral membrane protein, adherens junction, tight junction
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TJP2 Rabbit pAb images

ABclonal:Western blot - TJP2 Rabbit pAb (A0594)}

Western blot - TJP2 Rabbit pAb (A0594)

Western blot analysis of lysates from HeLa cells, using TJP2 Rabbit pAb (A0594) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
ABclonal:Immunoprecipitation - TJP2 Rabbit pAb (A0594)}

Immunoprecipitation - TJP2 Rabbit pAb (A0594)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg TJP2 antibody (A0594). Western blot was performed from the immunoprecipitate using TJP2 antibody (A0594) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A0594 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TJP2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TJP2. (Distance between topics and target gene indicate popularity.) TJP2

* Data provided by citexs.com, for reference only.

Publishing research using A0594? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order