Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TAS1R2 Rabbit pAb (A17218)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - TAS1R2 Rabbit pAb (A17218)

Western blot analysis of various lysates using TAS1R2 Rabbit pAb (A17218) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.

You may also interested in:

Overview

Product name TAS1R2 Rabbit pAb
Catalog No. A17218
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Contributes to sweet taste receptor activity. Involved in detection of chemical stimulus involved in sensory perception of sweet taste and positive regulation of cytokinesis. Part of sweet taste receptor complex.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human TAS1R2 (NP_689418.2).
Sequence IVQWQWDRSQNPFQSVASYYPLQRQLKNIQDISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPNNEWSYQSETS
Gene ID 80834
Swiss prot Q8TE23
Synonyms TR2; T1R2; GPR71; TAS1R2
Calculated MW 95kDa
Observed MW 95kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples MCF7, HeLa, 293T
Cellular location plasma membrane
Customer validation

WB (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TAS1R2 Rabbit pAb images

ABclonal:Western blot - TAS1R2 Rabbit pAb (A17218)}

Western blot - TAS1R2 Rabbit pAb (A17218)

Western blot analysis of various lysates using TAS1R2 Rabbit pAb (A17218) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.

Inquire About This Product

Submit your question about A17218 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TAS1R2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TAS1R2. (Distance between topics and target gene indicate popularity.) TAS1R2

* Data provided by citexs.com, for reference only.

Publishing research using A17218? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order