Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

STK26 Rabbit pAb (A16534)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - STK26 Rabbit pAb (A16534)

Western blot analysis of lysates from rat thymus, using STK26 Rabbit pAb (A16534) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Western blot - STK26 Rabbit pAb (A16534)

Western blot analysis of various lysates using STK26 Rabbit pAb (A16534) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - STK26 Rabbit pAb (A16534)

Immunohistochemistry analysis of STK26 in paraffin-embedded Human thyroid cancer using STK26 Rabbit pAb (A16534) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - STK26 Rabbit pAb (A16534)

Immunohistochemistry analysis of STK26 in paraffin-embedded Mouse spleen using STK26 Rabbit pAb (A16534) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name STK26 Rabbit pAb
Catalog No. A16534
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerization. The protein kinase localizes to the Golgi apparatus and is specifically activated by binding to the Golgi matrix protein GM130. It is also cleaved by caspase-3 in vitro, and may function in the apoptotic pathway. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 340-416 of human STK26 (NP_057626.2).
Sequence NGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP
Gene ID 51765
Swiss prot Q9P289
Synonyms MASK; MST4; STK26
Calculated MW 47kDa
Observed MW 47kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples U-87MG, HeLa, mouse thymus, mouse spleen, mouse lung, rat thymus
Cellular location Cytoplasm, Cytoplasmic side, Golgi apparatus membrane, Peripheral membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

STK26 Rabbit pAb images

ABclonal:Western blot - STK26 Rabbit pAb (A16534)}

Western blot - STK26 Rabbit pAb (A16534)

Western blot analysis of lysates from rat thymus, using STK26 Rabbit pAb (A16534) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Western blot - STK26 Rabbit pAb (A16534)}

Western blot - STK26 Rabbit pAb (A16534)

Western blot analysis of various lysates using STK26 Rabbit pAb (A16534) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - STK26 Rabbit pAb (A16534)}

Immunohistochemistry - STK26 Rabbit pAb (A16534)

Immunohistochemistry analysis of STK26 in paraffin-embedded Human thyroid cancer using STK26 Rabbit pAb (A16534) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - STK26 Rabbit pAb (A16534)}

Immunohistochemistry - STK26 Rabbit pAb (A16534)

Immunohistochemistry analysis of STK26 in paraffin-embedded Mouse spleen using STK26 Rabbit pAb (A16534) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A16534 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on STK26. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to STK26. (Distance between topics and target gene indicate popularity.) STK26

* Data provided by citexs.com, for reference only.

Publishing research using A16534? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order