Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Pan Cadherin Rabbit pAb |
---|---|
Catalog No. | A18682 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 800-882 of human pan-cadherin (NP_004351.1). |
---|---|
Sequence | RPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD |
Gene ID | 999100010011002 |
Swiss prot | P12830P19022P22223P55283 |
Synonyms | |
Calculated MW | |
Observed MW | 135kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Application key | Western blotting Immunoprecipitation |
Positive samples | PC-3, A-431, Mouse brain, Rat brain |
Cellular location | actin cytoskeleton, adherens junction, apical junction complex, cell junction, cytoplasm, cytoplasmic side of plasma membrane, endosome, extracellular exosome, extracellular region, flotillin complex, glutamatergic synapse, lateral plasma membrane, perinuclear region of cytoplasm, plasma membrane, trans-Golgi network |
Customer validation | WB (Houttuynia cordata) IHC (Houttuynia cordata) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A18682 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on CDH1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to CDH1. (Distance between topics and target gene indicate popularity.) CDH1
* Data provided by citexs.com, for reference only.
Publishing research using A18682? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.