Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Pan Cadherin Rabbit pAb (A18682)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Pan Cadherin Rabbit pAb (A18682)

Western blot analysis of various lysates using Pan Cadherin Rabbit pAb (A18682) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunoprecipitation - Pan Cadherin Rabbit pAb (A18682)

Immunoprecipitation analysis of 900 μg extracts of PC-3 cells using 3 μg Pan Cadherin antibody (A18682). Western blot was performed from the immunoprecipitate using Pan Cadherin antibody (A18682) at a dilution of 1:3000.

You may also interested in:

Overview

Product name Pan Cadherin Rabbit pAb
Catalog No. A18682
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Cadherin is one of a class of integral-membrane glycoproteins that are involved in cell to cell attachment for preserving the integrity of all solid tissues. Cadherins have three major regions: the Ca2+ -dependent extracellular region that mediates adhesion (cadherin to cadherin) for cell to cell binding; the transmembrane region; and the cytoplasmic region that extends into the cell and interacts with catenins, which in turn are linked to the actin of the cytoskeleton. Cadherins are differentially expressed during development and in adult organs. Since many cell types express multiple cadherin subclasses simultaneously (the combination differs with cell type), it can be inferred that the adhesion properities of individual cells are thus governed by varying the combinations of cadherins. Altered expression of cadherins are involved in invasion and metastasis of tumour cells. The classical cadherins (e.g. E-, N-, and P-cadherins) are the most common family members. E-cadherin (also known as uvomorulin) is concentrated in the belt desmosome in epithelial cells; N-cadherin is found in nerve, muscle, and lens cells and helps maintain the integrity of neuronal aggregates; P-cadherin is expressed in placental and epidermal cells.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-882 of human pan-cadherin (NP_004351.1).
Sequence RPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
Gene ID 999100010011002
Swiss prot P12830P19022P22223P55283
Synonyms
Calculated MW
Observed MW 135kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples PC-3, A-431, Mouse brain, Rat brain
Cellular location actin cytoskeleton, adherens junction, apical junction complex, cell junction, cytoplasm, cytoplasmic side of plasma membrane, endosome, extracellular exosome, extracellular region, flotillin complex, glutamatergic synapse, lateral plasma membrane, perinuclear region of cytoplasm, plasma membrane, trans-Golgi network
Customer validation

WB (Houttuynia cordata)

IHC (Houttuynia cordata)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Pan Cadherin Rabbit pAb images

ABclonal:Western blot - Pan Cadherin Rabbit pAb (A18682)}

Western blot - Pan Cadherin Rabbit pAb (A18682)

Western blot analysis of various lysates using Pan Cadherin Rabbit pAb (A18682) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunoprecipitation - Pan Cadherin Rabbit pAb (A18682)}

Immunoprecipitation - Pan Cadherin Rabbit pAb (A18682)

Immunoprecipitation analysis of 900 μg extracts of PC-3 cells using 3 μg Pan Cadherin antibody (A18682). Western blot was performed from the immunoprecipitate using Pan Cadherin antibody (A18682) at a dilution of 1:3000.

Inquire About This Product

Submit your question about A18682 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CDH1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CDH1. (Distance between topics and target gene indicate popularity.) CDH1

* Data provided by citexs.com, for reference only.

Publishing research using A18682? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order