Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PTRH2 Rabbit pAb (A6466)

Review (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PTRH2 Rabbit pAb (A6466)

Western blot analysis of extracts of various cell lines, using PTRH2 antibody (A6466) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - PTRH2 Rabbit pAb (A6466)

Immunohistochemistry analysis of paraffin-embedded rat brain using PTRH2 antibody (A6466) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PTRH2 Rabbit pAb (A6466)

Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using PTRH2 antibody (A6466) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PTRH2 Rabbit pAb (A6466)

Immunofluorescence analysis of MCF-7 cells using PTRH2 antibody (A6466). Blue: DAPI for nuclear staining.

Review
ABclonal: review for PTRH2 Rabbit pAb(A6466)

You may also interested in:

Overview

Product name PTRH2 Rabbit pAb
Catalog No. A6466
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a mitochondrial protein with two putative domains, an N-terminal mitochondrial localization sequence, and a UPF0099 domain. In vitro assays suggest that this protein possesses peptidyl-tRNA hydrolase activity, to release the peptidyl moiety from tRNA, thereby preventing the accumulation of dissociated peptidyl-tRNA that could reduce the efficiency of translation. This protein also plays a role regulating cell survival and death. It promotes survival as part of an integrin-signaling pathway for cells attached to the extracellular matrix (ECM), but also promotes apoptosis in cells that have lost their attachment to the ECM, a process called anoikos. After loss of cell attachment to the ECM, this protein is phosphorylated, is released from the mitochondria into the cytosol, and promotes caspase-independent apoptosis through interactions with transcriptional regulators. This gene has been implicated in the development and progression of tumors, and mutations in this gene have been associated with an infantile multisystem neurologic, endocrine, and pancreatic disease (INMEPD) characterized by intellectual disability, postnatal microcephaly, progressive cerebellar atrophy, hearing impairment, polyneuropathy, failure to thrive, and organ fibrosis with exocrine pancreas insufficiency (PMID: 25574476). Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-179 of human PTRH2 (NP_057161.1).
Sequence LPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
Gene ID 51651
Swiss prot Q9Y3E5
Synonyms PTH; BIT1; PTH2; PTH 2; CFAP37; IMNEPD; CGI-147; PTRH2
Calculated MW 19kDa
Observed MW 19kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:10 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples MCF7, BT-474, SW480, Mouse liver, Mouse spleen, Mouse thymus, Rat brain
Cellular location Mitochondrion
Customer validation

WB (HeLa)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PTRH2 Rabbit pAb images

ABclonal:Western blot - PTRH2 Rabbit pAb (A6466)}

Western blot - PTRH2 Rabbit pAb (A6466)

Western blot analysis of extracts of various cell lines, using PTRH2 antibody (A6466) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - PTRH2 Rabbit pAb (A6466)}

Immunohistochemistry - PTRH2 Rabbit pAb (A6466)

Immunohistochemistry analysis of paraffin-embedded rat brain using PTRH2 antibody (A6466) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PTRH2 Rabbit pAb (A6466)}

Immunohistochemistry - PTRH2 Rabbit pAb (A6466)

Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using PTRH2 antibody (A6466) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - PTRH2 Rabbit pAb (A6466)}

Immunofluorescence - PTRH2 Rabbit pAb (A6466)

Immunofluorescence analysis of MCF-7 cells using PTRH2 antibody (A6466). Blue: DAPI for nuclear staining.

Submit an review for A6466

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A6466 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PTRH2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PTRH2. (Distance between topics and target gene indicate popularity.) PTRH2

* Data provided by citexs.com, for reference only.

Publishing research using A6466? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order