Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PPP2R2B/PPP2R2C Rabbit pAb (A18572)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PPP2R2B/PPP2R2C Rabbit pAb (A18572)

Western blot analysis of various lysates using PPP2R2B/PPP2R2C Rabbit pAb (A18572) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

You may also interested in:

Overview

Product name PPP2R2B/PPP2R2C Rabbit pAb
Catalog No. A18572
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Protein phosphatase 3 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit.The B regulatory subunit might modulate substrate selectivity and catalytic activity.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 108-220 of human PPP2R2B/PPP2R2CPPP2R2B (NP_858060.2).
Sequence GDKGGRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLR
Gene ID 55215522
Swiss prot Q00005Q9Y2T4
Synonyms PPP2R2B/PPP2R2C
Calculated MW
Observed MW 52kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples MCF7, Mouse brain, Mouse testis, Rat brain, Rat testis
Cellular location cytoskeleton, cytosol, mitochondrial outer membrane, mitochondrion

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

PPP2R2B/PPP2R2C Rabbit pAb images

ABclonal:Western blot - PPP2R2B/PPP2R2C Rabbit pAb (A18572)}

Western blot - PPP2R2B/PPP2R2C Rabbit pAb (A18572)

Western blot analysis of various lysates using PPP2R2B/PPP2R2C Rabbit pAb (A18572) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Inquire About This Product

Submit your question about A18572 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PPP2R2B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PPP2R2B. (Distance between topics and target gene indicate popularity.) PPP2R2B

* Data provided by citexs.com, for reference only.

Publishing research using A18572? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order