Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PP2A Catalytic α Rabbit pAb (A6702)

Review (1) Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PP2A Catalytic α Rabbit pAb (A6702)

Western blot analysis of various lysates, using PP2A Catalytic α Rabbit pAb (A6702) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - PP2A Catalytic α Rabbit pAb (A6702)

Immunohistochemistry analysis of PP2A Catalytic α in paraffin-embedded mouse heart tissue using PP2A Catalytic α Rabbit pAb (A6702) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - PP2A Catalytic α Rabbit pAb (A6702)

Immunohistochemistry analysis of PP2A Catalytic α in paraffin-embedded human cervical cance tissue using PP2A Catalytic α Rabbit pAb (A6702) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - PP2A Catalytic α Rabbit pAb (A6702)

Immunohistochemistry analysis of PP2A Catalytic α in paraffin-embedded rat colon tissue using PP2A Catalytic α Rabbit pAb (A6702) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - PP2A Catalytic α Rabbit pAb (A6702)

Immunofluorescence analysis of HeLa cells using PP2A Catalytic α Rabbit pAb (A6702) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PP2A Catalytic α Rabbit pAb (A6702)

Immunofluorescence analysis of NIH/3T3 cells using PP2A Catalytic α Rabbit pAb (A6702) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - PP2A Catalytic α Rabbit pAb (A6702)

Immunoprecipitation analysis of 200 μg extracts of 293T cells using 3 μg PP2A Catalytic α antibody (A6702). Western blot was performed from the immunoprecipitate using PP2A Catalytic α antibody (A6702) at a dilution of 1:1000.

ABclonal:Immunoprecipitation - PP2A Catalytic α Rabbit pAb (A6702)

Immunoprecipitation analysis of 500 μg extracts of Rat brain cells using 3 μg PP2A Catalytic α antibody (A6702). Western blot was performed from the immunoprecipitate using PP2A Catalytic α antibody (A6702) at a dilution of 1:1000.

Review
ABclonal: review for PP2A Catalytic α Rabbit pAb(A6702)

You may also interested in:

Overview

Product name PP2A Catalytic α Rabbit pAb
Catalog No. A6702
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-309 of human PP2A Catalytic α (NP_002706.1).
Sequence MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Gene ID 5515
Swiss prot P67775
Synonyms RP-C; PP2Ac; PP2CA; NEDLBA; PP2Calpha; PP2A Catalytic α
Calculated MW 36kDa
Observed MW 36kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-500μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa, 293T, NIH/3T3, Rat brain
Cellular location Chromosome, Cytoplasm, Nucleus, centromere, cytoskeleton, spindle pole
Customer validation

WB (143B,MNNGMus musculus, Sus scrofa, Homo sapiens, Penaeus japonicus, Mus musculus)

IHC-P (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PP2A Catalytic α Rabbit pAb images

ABclonal:Western blot - PP2A Catalytic α Rabbit pAb (A6702)}

Western blot - PP2A Catalytic α Rabbit pAb (A6702)

Western blot analysis of various lysates, using PP2A Catalytic α Rabbit pAb (A6702) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - PP2A Catalytic α Rabbit pAb (A6702)}

Immunohistochemistry - PP2A Catalytic α Rabbit pAb (A6702)

Immunohistochemistry analysis of PP2A Catalytic α in paraffin-embedded mouse heart tissue using PP2A Catalytic α Rabbit pAb (A6702) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - PP2A Catalytic α Rabbit pAb (A6702)}

Immunohistochemistry - PP2A Catalytic α Rabbit pAb (A6702)

Immunohistochemistry analysis of PP2A Catalytic α in paraffin-embedded human cervical cance tissue using PP2A Catalytic α Rabbit pAb (A6702) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - PP2A Catalytic α Rabbit pAb (A6702)}

Immunohistochemistry - PP2A Catalytic α Rabbit pAb (A6702)

Immunohistochemistry analysis of PP2A Catalytic α in paraffin-embedded rat colon tissue using PP2A Catalytic α Rabbit pAb (A6702) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - PP2A Catalytic α Rabbit pAb (A6702)}

Immunofluorescence - PP2A Catalytic α Rabbit pAb (A6702)

Immunofluorescence analysis of HeLa cells using PP2A Catalytic α Rabbit pAb (A6702) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - PP2A Catalytic α Rabbit pAb (A6702)}

Immunofluorescence - PP2A Catalytic α Rabbit pAb (A6702)

Immunofluorescence analysis of NIH/3T3 cells using PP2A Catalytic α Rabbit pAb (A6702) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - PP2A Catalytic α Rabbit pAb (A6702)}

Immunoprecipitation - PP2A Catalytic α Rabbit pAb (A6702)

Immunoprecipitation analysis of 200 μg extracts of 293T cells using 3 μg PP2A Catalytic α antibody (A6702). Western blot was performed from the immunoprecipitate using PP2A Catalytic α antibody (A6702) at a dilution of 1:1000.
ABclonal:Immunoprecipitation - PP2A Catalytic α Rabbit pAb (A6702)}

Immunoprecipitation - PP2A Catalytic α Rabbit pAb (A6702)

Immunoprecipitation analysis of 500 μg extracts of Rat brain cells using 3 μg PP2A Catalytic α antibody (A6702). Western blot was performed from the immunoprecipitate using PP2A Catalytic α antibody (A6702) at a dilution of 1:1000.

Submit an review for A6702

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A6702 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PPP2CA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PPP2CA. (Distance between topics and target gene indicate popularity.) PPP2CA

* Data provided by citexs.com, for reference only.

Publishing research using A6702? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order