Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

PER2 Rabbit mAb (A5107)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - PER2 Rabbit mAb (A5107)

Western blot analysis of various lysates using PER2 Rabbit mAb (A5107) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Chromatin Immunoprecipitation - PER2 Rabbit mAb (A5107)

Chromatin immunoprecipitation analysis of extracts of MCF7 cells, using PER2 antibody (A5107) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

You may also interested in:

Overview

Product name PER2 Rabbit mAb
Catalog No. A5107
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1134

Background

This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene may increase the risk of getting certain cancers and have been linked to sleep disorders.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PER2 (O15055).
Sequence MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD
Gene ID 8864
Swiss prot O15055
Synonyms FASPS; FASPS1; PER2
Calculated MW 137kDa
Observed MW 140kDa

Applications

Reactivity Human
Tested applications Testing results
WB Human
IF/ICC HumanMouse
Recommended dilution
  • WB 1:500 - 1:2000
  • ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples BxPC-3, HeLa
Cellular location Cytoplasm, Nucleus, nucleolus, perinuclear region
Customer validation

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PER2 Rabbit mAb images

ABclonal:Western blot - PER2 Rabbit mAb (A5107)}

Western blot - PER2 Rabbit mAb (A5107)

Western blot analysis of various lysates using PER2 Rabbit mAb (A5107) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
ABclonal:Chromatin Immunoprecipitation - PER2 Rabbit mAb (A5107)}

Chromatin Immunoprecipitation - PER2 Rabbit mAb (A5107)

Chromatin immunoprecipitation analysis of extracts of MCF7 cells, using PER2 antibody (A5107) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Inquire About This Product

Submit your question about A5107 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PER2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PER2. (Distance between topics and target gene indicate popularity.) PER2

* Data provided by citexs.com, for reference only.

Publishing research using A5107? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order