Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PAK3 Rabbit pAb (A16942)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PAK3 Rabbit pAb (A16942)

Western blot analysis of various lysates using PAK3 Rabbit pAb (A16942) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - PAK3 Rabbit pAb (A16942)

Immunofluorescence analysis of NIH-3T3 cells using PAK3 Rabbit pAb (A16942) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name PAK3 Rabbit pAb
Catalog No. A16942
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a serine-threonine kinase and forms an activated complex with GTP-bound RAS-like (P21), CDC2 and RAC1. This protein may be necessary for dendritic development and for the rapid cytoskeletal reorganization in dendritic spines associated with synaptic plasticity. Defects in this gene are the cause of a non-syndromic form of X-linked intellectual disability. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAK3 (NP_001121638.1).
Sequence MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWAR
Gene ID 5063
Swiss prot O75914
Synonyms ARA; bPAK; MRX30; MRX47; OPHN3; PAK-3; XLID30; PAK3beta; beta-PAK; PAK3
Calculated MW 62kDa
Observed MW 80kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples U-251MG, Rat brain, Rat testis
Cellular location cytoplasm, cytosol, endosome, glutamatergic synapse, plasma membrane, postsynaptic density

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PAK3 Rabbit pAb images

ABclonal:Western blot - PAK3 Rabbit pAb (A16942)}

Western blot - PAK3 Rabbit pAb (A16942)

Western blot analysis of various lysates using PAK3 Rabbit pAb (A16942) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - PAK3 Rabbit pAb (A16942)}

Immunofluorescence - PAK3 Rabbit pAb (A16942)

Immunofluorescence analysis of NIH-3T3 cells using PAK3 Rabbit pAb (A16942) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A16942 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PAK3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PAK3. (Distance between topics and target gene indicate popularity.) PAK3

* Data provided by citexs.com, for reference only.

Publishing research using A16942? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order