Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

PAF1 Rabbit mAb (A3437)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PAF1 Rabbit mAb (A3437)

Western blot analysis of extracts of various cell lines, using PAF1 Rabbit mAb (A3437) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - PAF1 Rabbit mAb (A3437)

Immunohistochemistry analysis of paraffin-embedded human appendix using PAF1 Rabbit mAb (A3437) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name PAF1 Rabbit mAb
Catalog No. A3437
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2019

Background

This gene encodes a subunit of the polymerase associated factor (PAF1) complex. The PAF1 complex interacts with RNA polymerase II and plays a role in transcription elongation as well as histone modifications including ubiquitylation and methylation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAF1 (NP_061961.2).
Sequence MAPTIQTQAQREDGHRPNSHRTLPERSGVVCRVKYCNSLPDIPFDPKFITYPFDQNRFVQYKATSLEKQHKHDLLTEPDLGVTIDLINPDTYRIDPNVLL
Gene ID 54623
Swiss prot Q8N7H5
Synonyms PD2; F23149_1; PAF1
Calculated MW 60kDa
Observed MW 80kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P Human
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, A549, Mouse lung, Rat lung, Rat testis
Cellular location Nucleus
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

PAF1 Rabbit mAb images

ABclonal:Western blot - PAF1 Rabbit mAb (A3437)}

Western blot - PAF1 Rabbit mAb (A3437)

Western blot analysis of extracts of various cell lines, using PAF1 Rabbit mAb (A3437) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - PAF1 Rabbit mAb (A3437)}

Immunohistochemistry - PAF1 Rabbit mAb (A3437)

Immunohistochemistry analysis of paraffin-embedded human appendix using PAF1 Rabbit mAb (A3437) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A3437 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PAF1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PAF1. (Distance between topics and target gene indicate popularity.) PAF1

* Data provided by citexs.com, for reference only.

Publishing research using A3437? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order