Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PADI4 Rabbit pAb (A16188)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PADI4 Rabbit pAb (A16188)

Western blot analysis of various lysates using PADI4 Rabbit pAb (A16188) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - PADI4 Rabbit pAb (A16188)

Immunohistochemistry analysis of PADI4 in paraffin-embedded Human tonsil using PADI4 Rabbit pAb (A16188) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PADI4 Rabbit pAb (A16188)

Immunohistochemistry analysis of PADI4 in paraffin-embedded Rat spleen using PADI4 Rabbit pAb (A16188) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PADI4 Rabbit pAb (A16188)

Immunohistochemistry analysis of PADI4 in paraffin-embedded Rat bone marrow using PADI4 Rabbit pAb (A16188) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PADI4 Rabbit pAb (A16188)

Immunohistochemistry analysis of PADI4 in paraffin-embedded Mouse spleen using PADI4 Rabbit pAb (A16188) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name PADI4 Rabbit pAb
Catalog No. A16188
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 374-560 of human PADI4 (NP_036519.2).
Sequence RGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNRELLKRELGLA
Gene ID 23569
Swiss prot Q9UM07
Synonyms PAD; PAD4; PDI4; PDI5; PADI5; PADI4
Calculated MW 74kDa
Observed MW Refer to figures

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples A549, U-87 MG
Cellular location Cytoplasm, Cytoplasmic granule, Nucleus
Customer validation

IHC (Homo sapiens)

WB (Homo sapiens)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PADI4 Rabbit pAb images

ABclonal:Western blot - PADI4 Rabbit pAb (A16188)}

Western blot - PADI4 Rabbit pAb (A16188)

Western blot analysis of various lysates using PADI4 Rabbit pAb (A16188) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - PADI4 Rabbit pAb (A16188)}

Immunohistochemistry - PADI4 Rabbit pAb (A16188)

Immunohistochemistry analysis of PADI4 in paraffin-embedded Human tonsil using PADI4 Rabbit pAb (A16188) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PADI4 Rabbit pAb (A16188)}

Immunohistochemistry - PADI4 Rabbit pAb (A16188)

Immunohistochemistry analysis of PADI4 in paraffin-embedded Rat spleen using PADI4 Rabbit pAb (A16188) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PADI4 Rabbit pAb (A16188)}

Immunohistochemistry - PADI4 Rabbit pAb (A16188)

Immunohistochemistry analysis of PADI4 in paraffin-embedded Rat bone marrow using PADI4 Rabbit pAb (A16188) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PADI4 Rabbit pAb (A16188)}

Immunohistochemistry - PADI4 Rabbit pAb (A16188)

Immunohistochemistry analysis of PADI4 in paraffin-embedded Mouse spleen using PADI4 Rabbit pAb (A16188) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A16188 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PADI4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PADI4. (Distance between topics and target gene indicate popularity.) PADI4

* Data provided by citexs.com, for reference only.

Publishing research using A16188? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order