Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

JunD Rabbit pAb (A11955)

Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - JunD Rabbit pAb (A11955)

Western blot analysis of various lysates using JunD Rabbit pAb (A11955) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name JunD Rabbit pAb
Catalog No. A11955
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms (PMID:12105216).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human JunD (NP_005345.3).
Sequence METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPE
Gene ID 3727
Swiss prot P17535
Synonyms AP-1; JunD
Calculated MW 35kDa
Observed MW 35kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, Jurkat, 293T, HepG2, Mouse kidney, Mouse liver, Mouse pancreas, Mouse testis, Rat liver
Cellular location Nucleus
Customer validation

WB (Mus musculus)

IHC (Cervus nippon)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

JunD Rabbit pAb images

ABclonal:Western blot - JunD Rabbit pAb (A11955)}

Western blot - JunD Rabbit pAb (A11955)

Western blot analysis of various lysates using JunD Rabbit pAb (A11955) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about A11955 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on JUND. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to JUND. (Distance between topics and target gene indicate popularity.) JUND

* Data provided by citexs.com, for reference only.

Publishing research using A11955? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order