Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

HEYL Rabbit pAb (A17683)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - HEYL Rabbit pAb (A17683)

Western blot analysis of various lysates, using HEYL Rabbit pAb (A17683) at 1:2500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name HEYL Rabbit pAb
Catalog No. A17683
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The sequence of the encoded protein contains a conserved bHLH and orange domain, but its YRPW motif has diverged from other HESR family members. It is thought to be an effector of Notch signaling and a regulator of cell fate decisions. Alternatively spliced transcript variants have been found, but their biological validity has not been determined.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HEYL (NP_055386.2).
Sequence MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGIIEKRRRDRINSSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHA
Gene ID 26508
Swiss prot Q9NQ87
Synonyms HEY3; HRT3; HESR3; bHLHb33; HEYL
Calculated MW 35kDa
Observed MW 37kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U266, MDA-MB-231, Jurkat, Molt-4(Negative control)
Cellular location cytoplasm, nucleoplasm, nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

HEYL Rabbit pAb images

ABclonal:Western blot - HEYL Rabbit pAb (A17683)}

Western blot - HEYL Rabbit pAb (A17683)

Western blot analysis of various lysates, using HEYL Rabbit pAb (A17683) at 1:2500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A17683 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HEYL. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HEYL. (Distance between topics and target gene indicate popularity.) HEYL

* Data provided by citexs.com, for reference only.

Publishing research using A17683? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order