Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FAK Rabbit pAb (A11531)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse

ABclonal:Immunohistochemistry - FAK Rabbit pAb (A11531)

Immunohistochemistry analysis of FAK in paraffin-embedded mouse brain using FAK Rabbit pAb (A11531) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - FAK Rabbit pAb (A11531)

Immunofluorescence analysis of NIH/3T3 cells using FAK Rabbit pAb (A11531) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name FAK Rabbit pAb
Catalog No. A11531
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 700-840 of human FAK (NP_722560.1).
Sequence QHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLK
Gene ID 5747
Swiss prot Q05397
Synonyms FAK; FADK; FAK1; FRNK; FADK 1; PPP1R71; p125FAK; pp125FAK
Calculated MW 119kDa
Observed MW 125kDa

Applications

Reactivity Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Immunohistochemistry    Immunofluorescence    
Positive samples C2C12, U-87MG
Cellular location Cell junction, Cell membrane, Cytoplasm, Cytoplasmic side, Nucleus, Peripheral membrane protein, cell cortex, centrosome, cytoskeleton, focal adhesion, microtubule organizing center
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FAK Rabbit pAb images

ABclonal:Immunohistochemistry - FAK Rabbit pAb (A11531)}

Immunohistochemistry - FAK Rabbit pAb (A11531)

Immunohistochemistry analysis of FAK in paraffin-embedded mouse brain using FAK Rabbit pAb (A11531) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - FAK Rabbit pAb (A11531)}

Immunofluorescence - FAK Rabbit pAb (A11531)

Immunofluorescence analysis of NIH/3T3 cells using FAK Rabbit pAb (A11531) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A11531 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PTK2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PTK2. (Distance between topics and target gene indicate popularity.) PTK2

* Data provided by citexs.com, for reference only.

Publishing research using A11531? Please let us know so that we can cite the reference in this datasheet.

Antibodies (8)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order