Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

EpCAM Rabbit mAb (A1107)

PathoQIHC Pathology

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - EpCAM Rabbit mAb (A1107)

Western blot analysis of extracts of various cell lines, using EpCAM Rabbit mAb (A1107) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunohistochemistry - EpCAM Rabbit mAb (A1107)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - EpCAM Rabbit mAb (A1107)

Immunohistochemistry analysis of paraffin-embedded human colon using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - EpCAM Rabbit mAb (A1107)

Immunohistochemistry analysis of paraffin-embedded human kidney using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - EpCAM Rabbit mAb (A1107)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - EpCAM Rabbit mAb (A1107)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name EpCAM Rabbit mAb
Catalog No. A1107
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0521

Background

This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EpCAM (P16422).
Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCD
Gene ID 4072
Swiss prot P16422
Synonyms ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; BerEp4; EGP314; HNPCC8; LYNCH8; MOC-31; Ber-Ep4; TACSTD1; EpCAM
Calculated MW 35kDa
Observed MW 40kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P Human
WB MouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse kidney, Rat kidney
Cellular location Cell junction, Lateral cell membrane, Single-pass type I membrane protein, tight junction

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

EpCAM Rabbit mAb images

ABclonal:Western blot - EpCAM Rabbit mAb (A1107)}

Western blot - EpCAM Rabbit mAb (A1107)

Western blot analysis of extracts of various cell lines, using EpCAM Rabbit mAb (A1107) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
ABclonal:Immunohistochemistry - EpCAM Rabbit mAb (A1107)}

Immunohistochemistry - EpCAM Rabbit mAb (A1107)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - EpCAM Rabbit mAb (A1107)}

Immunohistochemistry - EpCAM Rabbit mAb (A1107)

Immunohistochemistry analysis of paraffin-embedded human colon using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - EpCAM Rabbit mAb (A1107)}

Immunohistochemistry - EpCAM Rabbit mAb (A1107)

Immunohistochemistry analysis of paraffin-embedded human kidney using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - EpCAM Rabbit mAb (A1107)}

Immunohistochemistry - EpCAM Rabbit mAb (A1107)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - EpCAM Rabbit mAb (A1107)}

Immunohistochemistry - EpCAM Rabbit mAb (A1107)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using EpCAM Rabbit mAb (A1107) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A1107 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EPCAM. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EPCAM. (Distance between topics and target gene indicate popularity.) EPCAM

* Data provided by citexs.com, for reference only.

Publishing research using A1107? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order