Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Cortactin Rabbit pAb (A15054)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Cortactin Rabbit pAb (A15054)

Western blot analysis of various lysates using Cortactin Rabbit pAb (A15054) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - Cortactin Rabbit pAb (A15054)

Immunohistochemistry analysis of Cortactin in paraffin-embedded human lung cancer using Cortactin Rabbit pAb (A15054) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Cortactin Rabbit pAb (A15054)

Immunohistochemistry analysis of Cortactin in paraffin-embedded human mammary cancer using Cortactin Rabbit pAb (A15054) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name Cortactin Rabbit pAb
Catalog No. A15054
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Cortactin (NP_612632.1).
Sequence MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYG
Gene ID 2017
Swiss prot Q14247
Synonyms EMS1; Cortactin
Calculated MW 62kDa
Observed MW 85kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples MCF7, HeLa
Cellular location Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Membrane, Peripheral membrane protein, cell cortex, clathrin-coated pit, cytoskeleton, dendrite, dendritic spine, focal adhesion, lamellipodium, podosome, ruffle

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cortactin Rabbit pAb images

ABclonal:Western blot - Cortactin Rabbit pAb (A15054)}

Western blot - Cortactin Rabbit pAb (A15054)

Western blot analysis of various lysates using Cortactin Rabbit pAb (A15054) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunohistochemistry - Cortactin Rabbit pAb (A15054)}

Immunohistochemistry - Cortactin Rabbit pAb (A15054)

Immunohistochemistry analysis of Cortactin in paraffin-embedded human lung cancer using Cortactin Rabbit pAb (A15054) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Cortactin Rabbit pAb (A15054)}

Immunohistochemistry - Cortactin Rabbit pAb (A15054)

Immunohistochemistry analysis of Cortactin in paraffin-embedded human mammary cancer using Cortactin Rabbit pAb (A15054) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A15054 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CTTN. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CTTN. (Distance between topics and target gene indicate popularity.) CTTN

* Data provided by citexs.com, for reference only.

Publishing research using A15054? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order