Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Complement C3 Rabbit mAb (A11196)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - Complement C3 Rabbit mAb (A11196)

Western blot analysis of extracts of HepG2 cells, using Complement Complement C3 Rabbit mAb (A11196) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

You may also interested in:

Overview

Product name Complement C3 Rabbit mAb
Catalog No. A11196
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0541

Background

Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form the mature protein, which is then further processed to generate numerous peptide products. The C3a peptide, also known as the C3a anaphylatoxin, modulates inflammation and possesses antimicrobial activity. Mutations in this gene are associated with atypical hemolytic uremic syndrome and age-related macular degeneration in human patients.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Complement Complement C3 (P01024).
Sequence GRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQL
Gene ID 718
Swiss prot P01024
Synonyms ASP; C3a; C3b; AHUS5; ARMD9; CPAMD1; HEL-S-62p; Complement C3
Calculated MW 187kDa
Observed MW 115kDa/187kDa

Applications

Reactivity Human
Tested applications Testing results
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2
Cellular location Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Complement C3 Rabbit mAb images

ABclonal:Western blot - Complement C3 Rabbit mAb (A11196)}

Western blot - Complement C3 Rabbit mAb (A11196)

Western blot analysis of extracts of HepG2 cells, using Complement Complement C3 Rabbit mAb (A11196) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Inquire About This Product

Submit your question about A11196 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on C3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to C3. (Distance between topics and target gene indicate popularity.) C3

* Data provided by citexs.com, for reference only.

Publishing research using A11196? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order