Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human
Product name | Complement C3 Rabbit mAb |
---|---|
Catalog No. | A11196 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0541 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Complement Complement C3 (P01024). |
---|---|
Sequence | GRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQL |
Gene ID | 718 |
Swiss prot | P01024 |
Synonyms | ASP; C3a; C3b; AHUS5; ARMD9; CPAMD1; HEL-S-62p; Complement C3 |
Calculated MW | 187kDa |
Observed MW | 115kDa/187kDa |
Reactivity | Human |
---|---|
Tested applications | Testing results |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | HepG2 |
Cellular location | Secreted |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A11196 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on C3. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to C3. (Distance between topics and target gene indicate popularity.) C3
* Data provided by citexs.com, for reference only.
Publishing research using A11196? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.