Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

COPS3 Rabbit pAb (A7017)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - COPS3 Rabbit pAb (A7017)

Western blot analysis of extracts of various cell lines, using COPS3 antibody (A7017) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - COPS3 Rabbit pAb (A7017)

Immunofluorescence analysis of MCF7 cells using COPS3 antibody (A7017). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name COPS3 Rabbit pAb
Catalog No. A7017
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 194-423 of human COPS3 (NP_003644.2).
Sequence GLKNFERALYFYEQAITTPAMAVSHIMLESYKKYILVSLILLGKVQQLPKYTSQIVGRFIKPLSNAYHELAQVYSTNNPSELRNLVNKHSETFTRDNNMGLVKQCLSSLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS
Gene ID 8533
Swiss prot Q9UNS2
Synonyms CSN3; SGN3; COPS3
Calculated MW 48kDa
Observed MW 48kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples SW480, HeLa, 293T, Mouse heart, Rat heart, Rat brian
Cellular location Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

COPS3 Rabbit pAb images

ABclonal:Western blot - COPS3 Rabbit pAb (A7017)}

Western blot - COPS3 Rabbit pAb (A7017)

Western blot analysis of extracts of various cell lines, using COPS3 antibody (A7017) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - COPS3 Rabbit pAb (A7017)}

Immunofluorescence - COPS3 Rabbit pAb (A7017)

Immunofluorescence analysis of MCF7 cells using COPS3 antibody (A7017). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A7017 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on COPS3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to COPS3. (Distance between topics and target gene indicate popularity.) COPS3

* Data provided by citexs.com, for reference only.

Publishing research using A7017? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order