Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CNTNAP3 Rabbit pAb (A8515)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CNTNAP3 Rabbit pAb (A8515)

Western blot analysis of extracts of various cell lines, using Cntnap3 Antibody (A8515) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name CNTNAP3 Rabbit pAb
Catalog No. A8515
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Located in axon. Is active in perikaryon. Is expressed in midbrain mantle layer; midbrain-hindbrain junction; and telencephalon mantle layer. Orthologous to several human genes including CNTNAP3 (contactin associated protein family member 3).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1078-1244 of mouse CNTNAP3 (NP_001074598.1).
Sequence LQVRYKLDRHRNADAFNFDLRNLADGHFHQLTINREEAVVSVEVNQSTKRQVILSSGTEFNAVKSLVLGKVLEPLDADPETQQAAAQGFTGCLSSVRFGLEVPLKAALNQNRARVTIQGSVAAAAHCAEGPGSAERKLSPGPSMDAGHSGSAEDRQPLPNTDRSDPG
Gene ID 238680
Swiss prot
Synonyms CNTNAP3; CASPR3; CNTNAP3A; Cntnap3
Calculated MW 140kDa
Observed MW 130kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-87MG, A-549, PC-3, Mouse pancreas
Cellular location Cell membrane, Secreted, Single-pass type I membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

CNTNAP3 Rabbit pAb images

ABclonal:Western blot - CNTNAP3 Rabbit pAb (A8515)}

Western blot - CNTNAP3 Rabbit pAb (A8515)

Western blot analysis of extracts of various cell lines, using Cntnap3 Antibody (A8515) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A8515 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Cntnap3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Cntnap3. (Distance between topics and target gene indicate popularity.) Cntnap3

* Data provided by citexs.com, for reference only.

Publishing research using A8515? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order