Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CHRNA5 Rabbit pAb (A1741)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CHRNA5 Rabbit pAb (A1741)

Western blot analysis of extracts of various cell lines, using CHRNA5 antibody (A1741) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

You may also interested in:

Overview

Product name CHRNA5 Rabbit pAb
Catalog No. A1741
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-240 of human CHRNA5 (NP_000736.2).
Sequence RCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYV
Gene ID 1138
Swiss prot P30532
Synonyms LNCR2; CHRNA5
Calculated MW 53kDa
Observed MW 50kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A-549, U-251MG, Jurkat, MCF-7, Mouse brain, Mouse stomach
Cellular location Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CHRNA5 Rabbit pAb images

ABclonal:Western blot - CHRNA5 Rabbit pAb (A1741)}

Western blot - CHRNA5 Rabbit pAb (A1741)

Western blot analysis of extracts of various cell lines, using CHRNA5 antibody (A1741) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Inquire About This Product

Submit your question about A1741 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CHRNA5. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CHRNA5. (Distance between topics and target gene indicate popularity.) CHRNA5

* Data provided by citexs.com, for reference only.

Publishing research using A1741? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order