Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CHRNA10 Rabbit pAb (A3042)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - CHRNA10 Rabbit pAb (A3042)

Western blot analysis of extracts of various cell lines, using CHRNA10 antibody (A3042) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

You may also interested in:

Overview

Product name CHRNA10 Rabbit pAb
Catalog No. A3042
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable acetylcholine-gated cation-selective channel activity. Acts upstream of or within positive regulation of cytosolic calcium ion concentration. Predicted to be located in membrane. Predicted to be active in cholinergic synapse and neuron projection. Predicted to be integral component of postsynaptic specialization membrane.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-240 of human CHRNA10 (NP_065135.2).
Sequence AEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGHQLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
Gene ID 57053
Swiss prot Q9GZZ6
Synonyms CHRNA10
Calculated MW 50kDa
Observed MW 45kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:200 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HL-60, U2OS
Cellular location Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CHRNA10 Rabbit pAb images

ABclonal:Western blot - CHRNA10 Rabbit pAb (A3042)}

Western blot - CHRNA10 Rabbit pAb (A3042)

Western blot analysis of extracts of various cell lines, using CHRNA10 antibody (A3042) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Inquire About This Product

Submit your question about A3042 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CHRNA10. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CHRNA10. (Distance between topics and target gene indicate popularity.) CHRNA10

* Data provided by citexs.com, for reference only.

Publishing research using A3042? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order