Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CHRFAM7A Rabbit pAb (A7844)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CHRFAM7A Rabbit pAb (A7844)

Western blot analysis of various lysates using CHRFAM7A Rabbit pAb (A7844) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 15s.

ABclonal:Immunohistochemistry - CHRFAM7A Rabbit pAb (A7844)

Immunohistochemistry analysis of CHRFAM7A in paraffin-embedded human prostate using CHRFAM7A Rabbit pAb (A7844) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CHRFAM7A Rabbit pAb (A7844)

Immunohistochemistry analysis of CHRFAM7A in paraffin-embedded human stomach using CHRFAM7A Rabbit pAb (A7844) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name CHRFAM7A Rabbit pAb
Catalog No. A7844
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7, which is located on chromosome 15 in a region associated with several neuropsychiatric disorders, is partially duplicated and forms a hybrid with a novel gene from the family with sequence similarity 7 (FAM7A). Alternative splicing has been observed, and two variants exist, for this hybrid gene. The N-terminally truncated products predicted by the largest open reading frames for each variant would lack the majority of the neurotransmitter-gated ion-channel ligand binding domain but retain the transmembrane region that forms the ion channel. Although current evidence supports transcription of this hybrid gene, translation of the nicotinic acetylcholine receptor-like protein-encoding open reading frames has not been confirmed.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CHRFAM7A (NP_647536.1).
Sequence MQKYCIYQHFQFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
Gene ID 89832
Swiss prot Q494W8
Synonyms D-10; CHRNA7; NACHRA7; CHRNA7-DR1; CHRFAM7A
Calculated MW 46kDa
Observed MW 46kDa/

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples A-549, Jurkat, SH-SY5Y, U-87MG, NIH/3T3, Mouse brain, Mouse spinal cord, Rat brain, Rat spinal cord, Jurkat, Mouse brain, Mouse spinal cord, Rat spinal cord
Cellular location Membrane, Multi-pass membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

CHRFAM7A Rabbit pAb images

ABclonal:Western blot - CHRFAM7A Rabbit pAb (A7844)}

Western blot - CHRFAM7A Rabbit pAb (A7844)

Western blot analysis of various lysates using CHRFAM7A Rabbit pAb (A7844) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 15s.
ABclonal:Immunohistochemistry - CHRFAM7A Rabbit pAb (A7844)}

Immunohistochemistry - CHRFAM7A Rabbit pAb (A7844)

Immunohistochemistry analysis of CHRFAM7A in paraffin-embedded human prostate using CHRFAM7A Rabbit pAb (A7844) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CHRFAM7A Rabbit pAb (A7844)}

Immunohistochemistry - CHRFAM7A Rabbit pAb (A7844)

Immunohistochemistry analysis of CHRFAM7A in paraffin-embedded human stomach using CHRFAM7A Rabbit pAb (A7844) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A7844 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CHRFAM7A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CHRFAM7A. (Distance between topics and target gene indicate popularity.) CHRFAM7A

* Data provided by citexs.com, for reference only.

Publishing research using A7844? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order