Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | CHRFAM7A Rabbit pAb |
---|---|
Catalog No. | A7844 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CHRFAM7A (NP_647536.1). |
---|---|
Sequence | MQKYCIYQHFQFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP |
Gene ID | 89832 |
Swiss prot | Q494W8 |
Synonyms | D-10; CHRNA7; NACHRA7; CHRNA7-DR1; CHRFAM7A |
Calculated MW | 46kDa |
Observed MW | 46kDa/ |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | A-549, Jurkat, SH-SY5Y, U-87MG, NIH/3T3, Mouse brain, Mouse spinal cord, Rat brain, Rat spinal cord, Jurkat, Mouse brain, Mouse spinal cord, Rat spinal cord |
Cellular location | Membrane, Multi-pass membrane protein |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A7844 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on CHRFAM7A. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to CHRFAM7A. (Distance between topics and target gene indicate popularity.) CHRFAM7A
* Data provided by citexs.com, for reference only.
Publishing research using A7844? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.