Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

CHD1L Rabbit mAb (A17558)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - CHD1L Rabbit mAb (A17558)

Western blot analysis of extracts of HepG2 cells, using CHD1L Rabbit mAb (A17558) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name CHD1L Rabbit mAb
Catalog No. A17558
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2153

Background

This gene encodes a DNA helicase protein involved in DNA repair. The protein converts ATP to add poly(ADP-ribose) as it regulates chromatin relaxation following DNA damage. Overexpression of this gene has been linked to several types of cancers.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human CHD1L (NP_004275.).
Sequence GEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLAL
Gene ID 9557
Swiss prot Q86WJ1
Synonyms ALC1; CHDL; CHD1L
Calculated MW 101kDa
Observed MW 101kDa

Applications

Reactivity Human
Tested applications Testing results
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Hep G2
Cellular location Cytosol, Chromosome, Nucleus, plasma membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

CHD1L Rabbit mAb images

ABclonal:Western blot - CHD1L Rabbit mAb (A17558)}

Western blot - CHD1L Rabbit mAb (A17558)

Western blot analysis of extracts of HepG2 cells, using CHD1L Rabbit mAb (A17558) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A17558 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CHD1L. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CHD1L. (Distance between topics and target gene indicate popularity.) CHD1L

* Data provided by citexs.com, for reference only.

Publishing research using A17558? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order