Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Annexin A4/Annexin IV Rabbit pAb (A6280)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Annexin A4/Annexin IV Rabbit pAb (A6280)

Western blot analysis of extracts of various cell lines, using Annexin A4/Annexin IV antibody (A6280) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

You may also interested in:

Overview

Product name Annexin A4/Annexin IV Rabbit pAb
Catalog No. A6280
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 112-321 of human Annexin A4/Annexin IV (NP_001144.1).
Sequence IEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Gene ID 307
Swiss prot P09525
Synonyms ANX4; P32.5; PIG28; PP4-X; ZAP36; PAP-II; HEL-S-274; Annexin A4/Annexin IV
Calculated MW 36kDa
Observed MW 35kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples BxPC-3, MCF7, A-549, SW620, HepG2, Mouse liver, Mouse kidney, Mouse lung, Rat kidney
Cellular location cell surface, cytoplasm, cytoplasmic vesicle, extracellular exosome, nuclear membrane, nucleus, perinuclear region of cytoplasm, plasma membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Annexin A4/Annexin IV Rabbit pAb images

ABclonal:Western blot - Annexin A4/Annexin IV Rabbit pAb (A6280)}

Western blot - Annexin A4/Annexin IV Rabbit pAb (A6280)

Western blot analysis of extracts of various cell lines, using Annexin A4/Annexin IV antibody (A6280) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Inquire About This Product

Submit your question about A6280 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ANXA4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ANXA4. (Distance between topics and target gene indicate popularity.) ANXA4

* Data provided by citexs.com, for reference only.

Publishing research using A6280? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order