Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

AKAP4 Rabbit pAb (A14813)

Publications (5) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - AKAP4 Rabbit pAb (A14813)

Western blot analysis of various lysates, using AKAP4 antibody (A14813) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - AKAP4 Rabbit pAb (A14813)

Immunofluorescence analysis of human testis cells using AKAP4 Rabbit pAb (A14813) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - AKAP4 Rabbit pAb (A14813)

Immunofluorescence analysis of rat testis cells using AKAP4 Rabbit pAb (A14813) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name AKAP4 Rabbit pAb
Catalog No. A14813
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is localized to the sperm flagellum and may be involved in the regulation of sperm motility. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 189-340 of human AKAP4 (NP_003877.2).
Sequence QSPSAPPAKPPSTQRAVISPDGECSIDDLSFYVNRLSSLVIQMAHKEIKEKLEGKSKCLHHSICPSPGNKERISPRTPASKIASEMAYEAVELTAAEMRGTGEESREGGQKSFLYSELSNKSKSGDKQMSQRESKEFADSISKGLMVYANQV
Gene ID 8852
Swiss prot Q5JQC9
Synonyms HI; p82; CT99; FSC1; PRKA4; AKAP-4; AKAP82; AKAP 82; hAKAP82; AKAP4
Calculated MW 94kDa
Observed MW 82kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Rat testis
Cellular location Cell projection, cilium, flagellum
Customer validation

WB (Mus musculus, Sus scrofa)

IF (Homo sapiens)

IB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

AKAP4 Rabbit pAb images

ABclonal:Western blot - AKAP4 Rabbit pAb (A14813)}

Western blot - AKAP4 Rabbit pAb (A14813)

Western blot analysis of various lysates, using AKAP4 antibody (A14813) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - AKAP4 Rabbit pAb (A14813)}

Immunofluorescence - AKAP4 Rabbit pAb (A14813)

Immunofluorescence analysis of human testis cells using AKAP4 Rabbit pAb (A14813) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - AKAP4 Rabbit pAb (A14813)}

Immunofluorescence - AKAP4 Rabbit pAb (A14813)

Immunofluorescence analysis of rat testis cells using AKAP4 Rabbit pAb (A14813) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A14813 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on AKAP4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to AKAP4. (Distance between topics and target gene indicate popularity.) AKAP4

* Data provided by citexs.com, for reference only.

Publishing research using A14813? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order