Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] CHRAC1 Rabbit pAb (A14896)

KO/KDValidated

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] CHRAC1 Rabbit pAb (A14896)

Western blot analysis of extracts from normal (control) and CHRAC1 knockout (KO) HeLa cells, using CHRAC1 antibody (A14896) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

You may also interested in:

Overview

Product name [KO Validated] CHRAC1 Rabbit pAb
Catalog No. A14896
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human CHRAC1 (NP_059140.1).
Sequence MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS
Gene ID 54108
Swiss prot Q9NRG0
Synonyms YCL1; CHARC1; CHARC15; CHRAC-1; CHRAC15; CHRAC-15; C1
Calculated MW 15kDa
Observed MW 14kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa
Cellular location Nucleus
Customer validation

WB (Homo sapiens)

IHC (Homo sapiens)

IF (Homo sapiens)

Co-IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] CHRAC1 Rabbit pAb images

ABclonal:Western blot - [KO Validated] CHRAC1 Rabbit pAb (A14896)}

Western blot - [KO Validated] CHRAC1 Rabbit pAb (A14896)

Western blot analysis of extracts from normal (control) and CHRAC1 knockout (KO) HeLa cells, using CHRAC1 antibody (A14896) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

Inquire About This Product

Submit your question about A14896 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CHRAC1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CHRAC1. (Distance between topics and target gene indicate popularity.) CHRAC1

* Data provided by citexs.com, for reference only.

Publishing research using A14896? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order