Product Type > Antibodies > Antibody Duos > Phosphorylated Antibody Duos

Phospho-PPP1R12A-S507 Antibody kit (RK04097)

Datasheet

ABclonal:Western blot - Phospho-PPP1R12A-S507 Rabbit pAb (AP0769)
ABclonal:Western blot - PPP1R12A Rabbit pAb (A0587)
ABclonal:Immunofluorescence - PPP1R12A Rabbit pAb (A0587)
ABclonal:Immunofluorescence - PPP1R12A Rabbit pAb (A0587)
ABclonal:Immunofluorescence - PPP1R12A Rabbit pAb (A0587)
ABclonal:Immunofluorescence - PPP1R12A Rabbit pAb (A0587)
ABclonal:Immunoprecipitation - PPP1R12A Rabbit pAb (A0587)

Overview

Product name Phospho-PPP1R12A-S507 Antibody kit
Catalog No. RK04097

Product Component

Product name Catalog No. Positive Applications Species Reactivity
Phospho-PPP1R12A-S507 Rabbit pAb AP0769 WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition Human
PPP1R12A Rabbit pAb A0587 WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition Human, Mouse, Rat
Myosin phosphatase target subunit 1, which is also called the myosin-binding subunit of myosin phosphatase, is one of the subunits of myosin phosphatase. Myosin phosphatase regulates the interaction of actin and myosin downstream of the guanosine triphosphatase Rho. The small guanosine triphosphatase Rho is implicated in myosin light chain (MLC) phosphorylation, which results in contraction of smooth muscle and interaction of actin and myosin in nonmuscle cells. The guanosine triphosphate (GTP)-bound, active form of RhoA (GTP.RhoA) specifically interacted with the myosin-binding subunit (MBS) of myosin phosphatase, which regulates the extent of phosphorylation of MLC. Rho-associated kinase (Rho-kinase), which is activated by GTP. RhoA, phosphorylated MBS and consequently inactivated myosin phosphatase. Overexpression of RhoA or activated RhoA in NIH 3T3 cells increased phosphorylation of MBS and MLC. Thus, Rho appears to inhibit myosin phosphatase through the action of Rho-kinase. Several transcript variants encoding different isoforms have been found for this gene.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PPP1R12A (NP_002471.1).
A synthetic phosphorylated peptide around S507 of human PPP1R12A (NP_001137357.1).
Sequence MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGG
LASTS
Gene ID 4659
Swiss prot O14974
Synonyms MBS; GUBS; M130; MYPT1; Phospho-PPP1R12A-S507
Calculated MW 115kDa
Observed MW 135kDa
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3.
Cellular location Cytoplasm
Phospho-PPP1R12A-S507 Rabbit pAb (AP0769)
ABclonal:Western blot - Phospho-PPP1R12A-S507 Rabbit pAb (AP0769)}
Western blot - Phospho-PPP1R12A-S507 Rabbit pAb (AP0769)

Western blot analysis of various lysates using Phospho-PPP1R12A-S507 Rabbit pAb (AP0769) at 1:2000 dilution or PPP1R12A antibody (A0587). HeLa cells were treated by Calyculin A (100 nM) at 37℃ for 30 minutes after serum-starvation overnight. Jurkat cells were treated by Calyculin A (100 nM) at 37℃ for 30 minutes.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.


PPP1R12A Rabbit pAb (A0587)
ABclonal:Western blot - PPP1R12A Rabbit pAb (A0587)}
Western blot - PPP1R12A Rabbit pAb (A0587)

Western blot analysis of various lysates using PPP1R12A Rabbit pAb (A0587) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - PPP1R12A Rabbit pAb (A0587)}
Immunofluorescence - PPP1R12A Rabbit pAb (A0587)

Immunofluorescence analysis of HeLa cells using PPP1R12A Rabbit pAb (A0587) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PPP1R12A Rabbit pAb (A0587)}
Immunofluorescence - PPP1R12A Rabbit pAb (A0587)

Immunofluorescence analysis of NIH/3T3 cells using PPP1R12A Rabbit pAb (A0587) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PPP1R12A Rabbit pAb (A0587)}
Immunofluorescence - PPP1R12A Rabbit pAb (A0587)

Immunofluorescence analysis of PC-12 cells using PPP1R12A Rabbit pAb (A0587) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - PPP1R12A Rabbit pAb (A0587)}
Immunofluorescence - PPP1R12A Rabbit pAb (A0587)

Immunofluorescence analysis of U2OS cells using PPP1R12A Rabbit pAb (A0587) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - PPP1R12A Rabbit pAb (A0587)}
Immunoprecipitation - PPP1R12A Rabbit pAb (A0587)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells, using 3 μg PPP1R12A antibody (A0587). Western blot was performed from the immunoprecipitate using PPP1R12A antibody (A0587) at a dilution of 1:1000.

Inquire About This Product

Submit your question about RK04097 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PPP1R12A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PPP1R12A. (Distance between topics and target gene indicate popularity.) PPP1R12A

* Data provided by citexs.com, for reference only.

Publishing research using RK04097? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Discontinued

Contact us to order