Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human
Product name | Phospho-PPP1R12A-S507 Antibody kit |
---|---|
Catalog No. | RK04097 |
Product name | Catalog No. | Positive Applications | Species Reactivity |
---|---|---|---|
Phospho-PPP1R12A-S507 Rabbit pAb | AP0769 | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition | Human |
PPP1R12A Rabbit pAb | A0587 | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition | Human, Mouse, Rat |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PPP1R12A (NP_002471.1). A synthetic phosphorylated peptide around S507 of human PPP1R12A (NP_001137357.1). |
---|---|
Sequence | MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGG LASTS |
Gene ID | 4659 |
Swiss prot | O14974 |
Synonyms | MBS; GUBS; M130; MYPT1; Phospho-PPP1R12A-S507 |
Calculated MW | 115kDa |
---|---|
Observed MW | 135kDa |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3. |
Cellular location | Cytoplasm |
Western blot analysis of various lysates using Phospho-PPP1R12A-S507 Rabbit pAb (AP0769) at 1:2000 dilution or PPP1R12A antibody (A0587). HeLa cells were treated by Calyculin A (100 nM) at 37℃ for 30 minutes after serum-starvation overnight. Jurkat cells were treated by Calyculin A (100 nM) at 37℃ for 30 minutes.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of various lysates using PPP1R12A Rabbit pAb (A0587) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Submit your question about RK04097 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on PPP1R12A. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to PPP1R12A. (Distance between topics and target gene indicate popularity.) PPP1R12A
* Data provided by citexs.com, for reference only.
Publishing research using RK04097? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
Discontinued