Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Phospho-MAP2K1-S298 Antibody kit |
---|---|
Catalog No. | RK04078 |
Product name | Catalog No. | Positive Applications | Species Reactivity |
---|---|---|---|
Phospho-MEK1-S298 Rabbit pAb | AP0063 | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition | Human, Mouse, Rat |
[KO Validated] MEK1 Rabbit pAb | A12687 | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK1 (NP_002746.1). A synthetic phosphorylated peptide around S298 of human MEK1 (NP_002746.1). |
---|---|
Sequence | MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIH PLSSY |
Gene ID | 5604 |
Swiss prot | Q02750 |
Synonyms | MEL; CFC3; MEK1; MKK1; MAPKK1; PRKMK1; Phospho-MEK1-S298 |
Calculated MW | 43kDa |
---|---|
Observed MW | 43kDa |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Cellular location | Cytoplasm,Membrane,Nucleus,Peripheral membrane protein,centrosome,cytoskeleton,microtubule organizing center,spindle pole body |
Western blot analysis of various lysates using Phospho-MEK1-S298 Rabbit pAb (AP0063) at 1:1000 dilution or MEK1 antibody (A12687). HeLa cells were treated by PMA/TPA (200 nM) at 37℃ for 15 minutes after serum-starvation overnight or treated by ATP(5 mM) at 30℃ for 1 hour.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of various lysates using Phospho-MEK1-S298 Rabbit pAb (AP0063) at 1:1000 dilution. C2C12 cells were treated by CIP(20uL/400ul) at 37℃ for 1 hour or treated by ATP(5 mM) at 30℃ for 1 hour. C6 cells were treated by CIP(20uL/400ul) at 37℃ for 1 hour or treated by ATP(5 mM) at 30℃ for 1 hour.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunoprecipitation analysis of 200 μg extracts of 293T cells, using 3 μg Phospho-MEK1-S298 pAb (AP0063). Western blot was performed from the immunoprecipitate using Phospho-MEK1-S298 pAb (AP0063) at a dilution of 1:1000. 293T cells were treated by PMA/TPA (200 nM) at 37℃ for 30 minutes after serum-starvation overnight.
Western blot analysis of various lysates using [KO Validated] MEK1 Rabbit pAb (A12687) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Western blot analysis of lysates from wild type (WT) and MEK1 knockout (KO) HeLa cells, using [KO Validated] MEK1 Rabbit pAb (A12687) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of MEK1 in paraffin-embedded Rat brain using [KO Validated] MEK1 Rabbit pAb (A12687) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of MEK1 in paraffin-embedded mouse kidney using [KO Validated] MEK1 Rabbit pAb (A12687) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Submit your question about RK04078 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on MAP2K1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to MAP2K1. (Distance between topics and target gene indicate popularity.) MAP2K1
* Data provided by citexs.com, for reference only.
Publishing research using RK04078? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
Discontinued