Product Type > Antibodies > Antibody Duos > Phosphorylated Antibody Duos

Phospho-MAP2K1-S298 Antibody kit (RK04078)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Phospho-MEK1-S298 Rabbit pAb (AP0063)
ABclonal:Western blot - Phospho-MEK1-S298 Rabbit pAb (AP0063)
ABclonal:Immunoprecipitation - Phospho-MEK1-S298 Rabbit pAb (AP0063)
ABclonal:Western blot - [KO Validated] MEK1 Rabbit pAb (A12687)
ABclonal:Western blot - [KO Validated] MEK1 Rabbit pAb (A12687)
ABclonal:Immunohistochemistry - [KO Validated] MEK1 Rabbit pAb (A12687)
ABclonal:Immunohistochemistry - [KO Validated] MEK1 Rabbit pAb (A12687)

Overview

Product name Phospho-MAP2K1-S298 Antibody kit
Catalog No. RK04078

Product Component

Product name Catalog No. Positive Applications Species Reactivity
Phospho-MEK1-S298 Rabbit pAb AP0063 WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition Human, Mouse, Rat
[KO Validated] MEK1 Rabbit pAb A12687 WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition Human, Mouse, Rat
The protein encoded by this gene is a member of the dual specificity protein kinase family, which acts as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein kinase lies upstream of MAP kinases and stimulates the enzymatic activity of MAP kinases upon wide variety of extra- and intracellular signals. As an essential component of MAP kinase signal transduction pathway, this kinase is involved in many cellular processes such as proliferation, differentiation, transcription regulation and development.
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK1 (NP_002746.1).
A synthetic phosphorylated peptide around S298 of human MEK1 (NP_002746.1).
Sequence MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIH
PLSSY
Gene ID 5604
Swiss prot Q02750
Synonyms MEL; CFC3; MEK1; MKK1; MAPKK1; PRKMK1; Phospho-MEK1-S298
Calculated MW 43kDa
Observed MW 43kDa
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Cellular location Cytoplasm,Membrane,Nucleus,Peripheral membrane protein,centrosome,cytoskeleton,microtubule organizing center,spindle pole body
Phospho-MEK1-S298 Rabbit pAb (AP0063)
ABclonal:Western blot - Phospho-MEK1-S298 Rabbit pAb (AP0063)}
Western blot - Phospho-MEK1-S298 Rabbit pAb (AP0063)

Western blot analysis of various lysates using Phospho-MEK1-S298 Rabbit pAb (AP0063) at 1:1000 dilution or MEK1 antibody (A12687). HeLa cells were treated by PMA/TPA (200 nM) at 37℃ for 15 minutes after serum-starvation overnight or treated by ATP(5 mM) at 30℃ for 1 hour.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - Phospho-MEK1-S298 Rabbit pAb (AP0063)}
Western blot - Phospho-MEK1-S298 Rabbit pAb (AP0063)

Western blot analysis of various lysates using Phospho-MEK1-S298 Rabbit pAb (AP0063) at 1:1000 dilution. C2C12 cells were treated by CIP(20uL/400ul) at 37℃ for 1 hour or treated by ATP(5 mM) at 30℃ for 1 hour. C6 cells were treated by CIP(20uL/400ul) at 37℃ for 1 hour or treated by ATP(5 mM) at 30℃ for 1 hour.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunoprecipitation - Phospho-MEK1-S298 Rabbit pAb (AP0063)}
Immunoprecipitation - Phospho-MEK1-S298 Rabbit pAb (AP0063)

Immunoprecipitation analysis of 200 μg extracts of 293T cells, using 3 μg Phospho-MEK1-S298 pAb (AP0063). Western blot was performed from the immunoprecipitate using Phospho-MEK1-S298 pAb (AP0063) at a dilution of 1:1000. 293T cells were treated by PMA/TPA (200 nM) at 37℃ for 30 minutes after serum-starvation overnight.


[KO Validated] MEK1 Rabbit pAb (A12687)
ABclonal:Western blot - [KO Validated] MEK1 Rabbit pAb (A12687)}
Western blot - [KO Validated] MEK1 Rabbit pAb (A12687)

Western blot analysis of various lysates using [KO Validated] MEK1 Rabbit pAb (A12687) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Western blot - [KO Validated] MEK1 Rabbit pAb (A12687)}
Western blot - [KO Validated] MEK1 Rabbit pAb (A12687)

Western blot analysis of lysates from wild type (WT) and MEK1 knockout (KO) HeLa cells, using [KO Validated] MEK1 Rabbit pAb (A12687) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - [KO Validated] MEK1 Rabbit pAb (A12687)}
Immunohistochemistry - [KO Validated] MEK1 Rabbit pAb (A12687)

Immunohistochemistry analysis of MEK1 in paraffin-embedded Rat brain using [KO Validated] MEK1 Rabbit pAb (A12687) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KO Validated] MEK1 Rabbit pAb (A12687)}
Immunohistochemistry - [KO Validated] MEK1 Rabbit pAb (A12687)

Immunohistochemistry analysis of MEK1 in paraffin-embedded mouse kidney using [KO Validated] MEK1 Rabbit pAb (A12687) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about RK04078 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAP2K1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MAP2K1. (Distance between topics and target gene indicate popularity.) MAP2K1

* Data provided by citexs.com, for reference only.

Publishing research using RK04078? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Discontinued

Alternative Products
Contact us to order