Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Phospho-GRIA1-S845 Antibody Kit |
---|---|
Catalog No. | RK04093 |
Product name | Catalog No. | Positive Applications | Species Reactivity |
---|---|---|---|
Phospho-GluR1/GRIA1-S845 Rabbit pAb | AP0825 | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition | Human, Mouse, Rat |
GluR1/GRIA1 Rabbit pAb | A1826 | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition | Human, Mouse, Rat |
Immunogen | A phospho specific peptide corresponding to residues surrounding S845 of human GRIA1 Recombinant fusion protein containing a sequence corresponding to amino acids 19-300 of human GRIA1 (NP_000818.2).Recombinant fusion protein containing a sequence corresponding to amino acids 330-470 of human GluR1/GRIA1 (NP_000818.2). A phospho specific peptide corresponding to residues surrounding S845 of human GluR1/GRIA1 |
---|---|
Sequence | PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPD |
Gene ID | 2890 |
Swiss prot | P42261 |
Synonyms | GLUH1; GLUR1; GLURA; GluA1; HBGR1; MRD67; MRT76; Phospho-GluR1/GRIA1-S845 |
Calculated MW | 102kDa |
---|---|
Observed MW | 90kDa |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3. |
Cellular location | Cell junction,Cell membrane,Cell projection,Endoplasmic reticulum membrane,Multi-pass membrane protein,dendrite,dendritic spine,postsynaptic cell membrane,postsynaptic density,synapse |
Western blot analysis of lysates from SH-SY5Y cells, using Phospho-GluR1/GRIA1-S845 Rabbit pAb (AP0825) at 1:1000 dilution or GluR1/GRIA1 antibody (A1826). SH-SY5Y cells were treated by CIP(20uL/400ul) at 37℃ for 1 hour.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
Western blot analysis of various lysates, using GluR1/GRIA1 Rabbit pAb (A1826) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of GluR1/GRIA1 in paraffin-embedded mouse brain using GluR1/GRIA1 Rabbit pAb (A1826) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Submit your question about RK04093 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on GRIA1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to GRIA1. (Distance between topics and target gene indicate popularity.) GRIA1
* Data provided by citexs.com, for reference only.
Publishing research using RK04093? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
Discontinued