Product Type > Antibodies > Antibody Duos > Phosphorylated Antibody Duos

Phospho-GRIA1-S845 Antibody Kit (RK04093)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Phospho-GluR1/GRIA1-S845 Rabbit pAb (AP0825)
ABclonal:Western blot - GluR1/GRIA1 Rabbit pAb (A1826)
ABclonal:Immunohistochemistry - GluR1/GRIA1 Rabbit pAb (A1826)

Overview

Product name Phospho-GRIA1-S845 Antibody Kit
Catalog No. RK04093

Product Component

Product name Catalog No. Positive Applications Species Reactivity
Phospho-GluR1/GRIA1-S845 Rabbit pAb AP0825 WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition Human, Mouse, Rat
GluR1/GRIA1 Rabbit pAb A1826 WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition Human, Mouse, Rat
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Immunogen A phospho specific peptide corresponding to residues surrounding S845 of human GRIA1
Recombinant fusion protein containing a sequence corresponding to amino acids 19-300 of human GRIA1 (NP_000818.2).Recombinant fusion protein containing a sequence corresponding to amino acids 330-470 of human GluR1/GRIA1 (NP_000818.2).
A phospho specific peptide corresponding to residues surrounding S845 of human GluR1/GRIA1
Sequence PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPD

Gene ID 2890
Swiss prot P42261
Synonyms GLUH1; GLUR1; GLURA; GluA1; HBGR1; MRD67; MRT76; Phospho-GluR1/GRIA1-S845
Calculated MW 102kDa
Observed MW 90kDa
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3.
Cellular location Cell junction,Cell membrane,Cell projection,Endoplasmic reticulum membrane,Multi-pass membrane protein,dendrite,dendritic spine,postsynaptic cell membrane,postsynaptic density,synapse
Phospho-GluR1/GRIA1-S845 Rabbit pAb (AP0825)
ABclonal:Western blot - Phospho-GluR1/GRIA1-S845 Rabbit pAb (AP0825)}
Western blot - Phospho-GluR1/GRIA1-S845 Rabbit pAb (AP0825)

Western blot analysis of lysates from SH-SY5Y cells, using Phospho-GluR1/GRIA1-S845 Rabbit pAb (AP0825) at 1:1000 dilution or GluR1/GRIA1 antibody (A1826). SH-SY5Y cells were treated by CIP(20uL/400ul) at 37℃ for 1 hour.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.


GluR1/GRIA1 Rabbit pAb (A1826)
ABclonal:Western blot - GluR1/GRIA1 Rabbit pAb (A1826)}
Western blot - GluR1/GRIA1 Rabbit pAb (A1826)

Western blot analysis of various lysates, using GluR1/GRIA1 Rabbit pAb (A1826) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - GluR1/GRIA1 Rabbit pAb (A1826)}
Immunohistochemistry - GluR1/GRIA1 Rabbit pAb (A1826)

Immunohistochemistry analysis of GluR1/GRIA1 in paraffin-embedded mouse brain using GluR1/GRIA1 Rabbit pAb (A1826) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about RK04093 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GRIA1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GRIA1. (Distance between topics and target gene indicate popularity.) GRIA1

* Data provided by citexs.com, for reference only.

Publishing research using RK04093? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Discontinued

Contact us to order