Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human
Product name | Phospho-EGFR-Y1086 Antibody kit |
---|---|
Catalog No. | RK04082 |
Product name | Catalog No. | Positive Applications | Species Reactivity |
---|---|---|---|
Phospho-EGFR-Y1086 Rabbit pAb | AP0820 | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition | Human |
EGFR Rabbit pAb | A11351 | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition | Human, Mouse, Rat |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1021-1210 of human EGFR (NP_005219.2). A synthetic phosphorylated peptide around Y1086 of human EGFR (NP_005219.2). |
---|---|
Sequence | QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA PVYHN |
Gene ID | 1956 |
Swiss prot | P00533 |
Synonyms | ERBB; ERRP; HER1; mENA; ERBB1; PIG61; NISBD2; Phospho-EGFR-Y1086 |
Calculated MW | 134kDa |
---|---|
Observed MW | 175kDa |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3. |
Cellular location | Cell membrane,Endoplasmic reticulum membrane,Endosome,Endosome membrane,Golgi apparatus membrane,Nucleus membrane,Nucleus,Secreted,Single-pass type I membrane protein |
Western blot analysis of lysates from A-431 cells, using Phospho-EGFR-Y1086 Rabbit pAb (AP0820) at 1:1000 dilution or EGFR antibody (A11351). A-431 cells were treated by EGF (100 ng/mL) at 37℃ for 30 minutes after serum-starvation overnight.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of lysates from A431 cells, using EGFR Rabbit pAb (A11351) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Submit your question about RK04082 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on EGFR. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to EGFR. (Distance between topics and target gene indicate popularity.) EGFR
* Data provided by citexs.com, for reference only.
Publishing research using RK04082? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
Discontinued