Product Type > Antibodies > Antibody Duos > Phosphorylated Antibody Duos

Phospho-EGFR-Y1045 Antibody kit (RK04080)

Datasheet

ABclonal:Western blot - Phospho-EGFR-Y1045 Rabbit pAb (AP0819)
ABclonal:Western blot - EGFR Rabbit pAb (A11351)
ABclonal:Immunohistochemistry - EGFR Rabbit pAb (A11351)
ABclonal:Immunohistochemistry - EGFR Rabbit pAb (A11351)
ABclonal:Immunohistochemistry - EGFR Rabbit pAb (A11351)
ABclonal:Immunofluorescence - EGFR Rabbit pAb (A11351)
ABclonal:Immunoprecipitation - EGFR Rabbit pAb (A11351)

Overview

Product name Phospho-EGFR-Y1045 Antibody kit
Catalog No. RK04080

Product Component

Product name Catalog No. Positive Applications Species Reactivity
Phospho-EGFR-Y1045 Rabbit pAb AP0819 WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition Human
EGFR Rabbit pAb A11351 WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition Human, Mouse, Rat
The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2).
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1021-1210 of human EGFR (NP_005219.2).
A synthetic phosphorylated peptide around Y1045 of human EGFR (NP_005219.2).
Sequence QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA
QRYSS
Gene ID 1956
Swiss prot P00533
Synonyms ERBB; ERRP; HER1; mENA; ERBB1; PIG61; NISBD2; Phospho-EGFR-Y1045
Calculated MW 134kDa
Observed MW 180kDa
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal,50% glycerol,pH7.3.
Cellular location Cell membrane,Endoplasmic reticulum membrane,Endosome,Endosome membrane,Golgi apparatus membrane,Nucleus membrane,Nucleus,Secreted,Single-pass type I membrane protein
Phospho-EGFR-Y1045 Rabbit pAb (AP0819)
ABclonal:Western blot - Phospho-EGFR-Y1045 Rabbit pAb (AP0819)}
Western blot - Phospho-EGFR-Y1045 Rabbit pAb (AP0819)

Western blot analysis of lysates from A-431 cells, using Phospho-EGFR-Y1045 Rabbit pAb (AP0819) at 1:1000 dilution or EGFR antibody (A11351). A-431 cells were treated by EGF (100 ng/mL) at 37℃ for 30 minutes after serum-starvation overnight.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.


EGFR Rabbit pAb (A11351)
ABclonal:Western blot - EGFR Rabbit pAb (A11351)}
Western blot - EGFR Rabbit pAb (A11351)

Western blot analysis of lysates from A431 cells, using EGFR Rabbit pAb (A11351) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - EGFR Rabbit pAb (A11351)}
Immunohistochemistry - EGFR Rabbit pAb (A11351)

Immunohistochemistry analysis of EGFR in paraffin-embedded Rat liver using EGFR Rabbit pAb (A11351) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - EGFR Rabbit pAb (A11351)}
Immunohistochemistry - EGFR Rabbit pAb (A11351)

Immunohistochemistry analysis of EGFR in paraffin-embedded Human placenta using EGFR Rabbit pAb (A11351) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - EGFR Rabbit pAb (A11351)}
Immunohistochemistry - EGFR Rabbit pAb (A11351)

Immunohistochemistry analysis of EGFR in paraffin-embedded Mouse heart using EGFR Rabbit pAb (A11351) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - EGFR Rabbit pAb (A11351)}
Immunofluorescence - EGFR Rabbit pAb (A11351)

Immunofluorescence analysis of A-431 cells using EGFR Rabbit pAb (A11351) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - EGFR Rabbit pAb (A11351)}
Immunoprecipitation - EGFR Rabbit pAb (A11351)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 3 μg EGFR antibody (A11351). Western blot was performed from the immunoprecipitate using EGFR antibody (A11351) at a dilution of 1:1000.

Inquire About This Product

Submit your question about RK04080 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EGFR. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EGFR. (Distance between topics and target gene indicate popularity.) EGFR

* Data provided by citexs.com, for reference only.

Publishing research using RK04080? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Discontinued

Alternative Products
Contact us to order