Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

p38 MAPK Rabbit pAb (A5521)

Reviews (3) Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - p38 MAPK Rabbit pAb (A5521)

Western blot analysis of various lysates using p38 MAPK Rabbit pAb (A5521) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Review
ABclonal: review for p38 MAPK Rabbit pAb(A5521)
Review
ABclonal: review for p38 MAPK Rabbit pAb(A5521)
Review
ABclonal: review for p38 MAPK Rabbit pAb(A5521)

You may also interested in:

Overview

Product name p38 MAPK Rabbit pAb
Catalog No. A5521
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 261-360 of human p38 MAPK (NP_620581.1).
Sequence SLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Gene ID 1432
Swiss prot Q16539
Synonyms RK; p38; CSBP; EXIP; Mxi2; CSBP1; CSBP2; CSPB1; PRKM14; PRKM15; SAPK2A; p38ALPHA; p38 MAPK
Calculated MW 41kDa
Observed MW 41kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Jurkat, Rat kidney
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Mouse embryonal fibroblast cell, mouse cells, HepG2Homo sapiens)

IHC (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

p38 MAPK Rabbit pAb images

ABclonal:Western blot - p38 MAPK Rabbit pAb (A5521)}

Western blot - p38 MAPK Rabbit pAb (A5521)

Western blot analysis of various lysates using p38 MAPK Rabbit pAb (A5521) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Submit an review for A5521

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A5521 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAPK14. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MAPK14. (Distance between topics and target gene indicate popularity.) MAPK14

* Data provided by citexs.com, for reference only.

Publishing research using A5521? Please let us know so that we can cite the reference in this datasheet.

Antibodies (12)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order