Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | [One Step]P2RY14 Antibody Kit |
---|---|
Catalog No. | RK05675 |
Component | Name | Recommended Dilution | Applications | Species Reactivity |
---|---|---|---|---|
Primary Antibody | P2RY14 Rabbit pAb | 1:1000 dilution | WB | Human, Mouse, Rat |
Secondary Antibody | HRP Goat Anti-Rabbit IgG (H+L) | 1:10000 dilution |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 209-338 of human P2RY14 (NP_055694.3). |
---|---|
Sequence | ITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVFVFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL |
Gene ID | 9934 |
Swiss prot | Q15391 |
Synonyms | P2RY14; BPR105; GPR105; P2Y14 |
Calculated MW | 38kDa |
---|---|
Observed MW | 42kDa |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Cellular location | Cell membrane,Multi-pass membrane protein |
Submit your question about RK05675 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
* For research use only. Not for therapeutic or diagnostic purposes.