Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ZNF564 Rabbit pAb (A15572)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

You may also interested in:

Overview

Product name ZNF564 Rabbit pAb
Catalog No. A15572
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable DNA-binding transcription factor activity and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human ZNF564 (NP_659413.1).
Sequence RDVMRETFRNLACVGKKWEDQSIEDWYKNQGRILRNHMEEGLSESKEYDQCGEAFSQILNLNLNKKIPTIVRPCECSLCGK
Gene ID 163050
Swiss prot Q8TBZ8
Synonyms ZNF564
Calculated MW 64kDa
Observed MW Refer to figures

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:200 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples
Cellular location Nucleus

Research Area

Inquire About This Product

Submit your question about A15572 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZNF564. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ZNF564. (Distance between topics and target gene indicate popularity.) ZNF564

* Data provided by citexs.com, for reference only.

Publishing research using A15572? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order