Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

XBP1 Rabbit pAb (A1731)

Review (1) Publications (26) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - XBP1 Rabbit pAb (A1731)

Western blot analysis of lysates from Mouse spleen, using XBP1 Rabbit pAb (A1731) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - XBP1 Rabbit pAb (A1731)

Immunofluorescence analysis of NIH/3T3 cells using XBP1 Rabbit pAb (A1731) at dilution of 1:100 (40x lens).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for XBP1 Rabbit pAb(A1731)

You may also interested in:

Overview

Product name XBP1 Rabbit pAb
Catalog No. A1731
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. This gene product is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhancer in the promoter of the T cell leukemia virus type 1 promoter. It may increase expression of viral proteins by acting as the DNA binding partner of a viral transactivator. It has been found that upon accumulation of unfolded proteins in the endoplasmic reticulum (ER), the mRNA of this gene is processed to an active form by an unconventional splicing mechanism that is mediated by the endonuclease inositol-requiring enzyme 1 (IRE1). The resulting loss of 26 nt from the spliced mRNA causes a frame-shift and an isoform XBP1(S), which is the functionally active transcription factor. The isoform encoded by the unspliced mRNA, XBP1(U), is constitutively expressed, and thought to function as a negative feedback regulator of XBP1(S), which shuts off transcription of target genes during the recovery phase of ER stress. A pseudogene of XBP1 has been identified and localized to chromosome 5.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids1-70 of human XBP1 (NP_005071.2).
Sequence MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPE
Gene ID 7494
Swiss prot P17861
Synonyms XBP2; TREB5; XBP-1; TREB-5; XBP1
Calculated MW 29kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse spleen
Cellular location Cytoplasm, Endoplasmic reticulum membrane, Endoplasmic reticulum, Membrane, Nucleus, Peripheral membrane protein, Single-pass type II membrane protein
Customer validation

WB (RAW264.7Mus musculus, Mus musculus, Rattus norvegicus, Homo sapiens, Bos taurus, Gallus gallus, Sus scrofa)

IHC (Rattus norvegicus)

IF (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

XBP1 Rabbit pAb images

ABclonal:Western blot - XBP1 Rabbit pAb (A1731)}

Western blot - XBP1 Rabbit pAb (A1731)

Western blot analysis of lysates from Mouse spleen, using XBP1 Rabbit pAb (A1731) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - XBP1 Rabbit pAb (A1731)}

Immunofluorescence - XBP1 Rabbit pAb (A1731)

Immunofluorescence analysis of NIH/3T3 cells using XBP1 Rabbit pAb (A1731) at dilution of 1:100 (40x lens).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A1731

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1731 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on XBP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to XBP1. (Distance between topics and target gene indicate popularity.) XBP1

* Data provided by citexs.com, for reference only.

Publishing research using A1731? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order