Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

UBP1 Rabbit pAb (A4177)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - UBP1 Rabbit pAb (A4177)

Western blot analysis of extracts of various cell lines, using UBP1 antibody (A4177) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

You may also interested in:

Overview

Product name UBP1 Rabbit pAb
Catalog No. A4177
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in negative regulation of viral transcription and positive regulation of transcription by RNA polymerase II. Located in cytosol and nucleoplasm.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 280-380 of human UBP1 (NP_055332.3).
Sequence IEDAVEHEQKKSSKRTLPADYGDSLAKRGSCSPWPDAPTAYVNNSPSPAPTFTSPQQSTCSVPDSNSSSPNHQGDGASQTSGEQIQPSATIQETQQWLLKN
Gene ID 7342
Swiss prot Q9NZI7
Synonyms LBP1A; LBP1B; LBP-1B; LBP-1a; UBP1
Calculated MW 60kDa
Observed MW 50kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2, HeLa, MCF7, K-562
Cellular location Nucleus

Research Area

UBP1 Rabbit pAb images

ABclonal:Western blot - UBP1 Rabbit pAb (A4177)}

Western blot - UBP1 Rabbit pAb (A4177)

Western blot analysis of extracts of various cell lines, using UBP1 antibody (A4177) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Inquire About This Product

Submit your question about A4177 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on UBP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to UBP1. (Distance between topics and target gene indicate popularity.) UBP1

* Data provided by citexs.com, for reference only.

Publishing research using A4177? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order