Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

LPCAT1 Rabbit pAb (A4987)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - LPCAT1 Rabbit pAb (A4987)

Western blot analysis of various lysates, using LPCAT1 antibody (A4987) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - LPCAT1 Rabbit pAb (A4987)

Immunofluorescence analysis of MCF7 cells using LPCAT1 Rabbit pAb (A4987) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name LPCAT1 Rabbit pAb
Catalog No. A4987
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the 1-acyl-sn-glycerol-3-phosphate acyltransferase family of proteins. The encoded enzyme plays a role in phospholipid metabolism, specifically in the conversion of lysophosphatidylcholine to phosphatidylcholine in the presence of acyl-CoA. This process is important in the synthesis of lung surfactant and platelet-activating factor (PAF). Elevated expression of this gene may contribute to the progression of oral squamous cell, prostate, breast, and other human cancers.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 325-534 of human LPCAT1 (NP_079106.3).
Sequence LPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD
Gene ID 79888
Swiss prot Q8NF37
Synonyms AYTL2; lpcat; AGPAT9; LPLAT8; PFAAP3; AGPAT10; LPCAT-1; lysoPAFAT; LPCAT1
Calculated MW 59kDa
Observed MW 59kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T, PC-3, A-549
Cellular location Endoplasmic reticulum membrane, Golgi apparatus membrane, Lipid droplet, Single-pass type II membrane protein
Customer validation

WB (Homo sapiens)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

LPCAT1 Rabbit pAb images

ABclonal:Western blot - LPCAT1 Rabbit pAb (A4987)}

Western blot - LPCAT1 Rabbit pAb (A4987)

Western blot analysis of various lysates, using LPCAT1 antibody (A4987) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - LPCAT1 Rabbit pAb (A4987)}

Immunofluorescence - LPCAT1 Rabbit pAb (A4987)

Immunofluorescence analysis of MCF7 cells using LPCAT1 Rabbit pAb (A4987) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A4987 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LPCAT1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LPCAT1. (Distance between topics and target gene indicate popularity.) LPCAT1

* Data provided by citexs.com, for reference only.

Publishing research using A4987? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order