Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

FOXM1 Rabbit pAb (A2493)

Review (1) Publications (8) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - FOXM1 Rabbit pAb (A2493)

Western blot analysis of various lysates using FOXM1 Rabbit pAb (A2493) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - FOXM1 Rabbit pAb (A2493)

Immunofluorescence analysis of paraffin-embedded Mouse colon tissue using FOXM1 Rabbit pAb(A2493) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Chromatin Immunoprecipitation - FOXM1 Rabbit pAb (A2493)

Chromatin immunoprecipitation analysis of extracts of 293T cells, using FOXM1 antibody (A2493) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Review
ABclonal: review for FOXM1 Rabbit pAb(A2493)

You may also interested in:

Overview

Product name FOXM1 Rabbit pAb
Catalog No. A2493
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a transcriptional activator involved in cell proliferation. The encoded protein is phosphorylated in M phase and regulates the expression of several cell cycle genes, such as cyclin B1 and cyclin D1. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-128 of human FOXM1 (NP_068772.2).
Sequence EEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTS
Gene ID 2305
Swiss prot Q08050
Synonyms MPP2; HFH11; HNF-3; INS-1; MPP-2; PIG29; FKHL16; FOXM1A; FOXM1B; FOXM1C; HFH-11; TRIDENT; MPHOSPH2; FOXM1
Calculated MW 84kDa
Observed MW 110kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
  • ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, HT-29
Cellular location Nucleus
Customer validation

WB (A549Homo sapiens, Homo sapiens, Mus musculus)

IHC (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FOXM1 Rabbit pAb images

ABclonal:Western blot - FOXM1 Rabbit pAb (A2493)}

Western blot - FOXM1 Rabbit pAb (A2493)

Western blot analysis of various lysates using FOXM1 Rabbit pAb (A2493) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - FOXM1 Rabbit pAb (A2493)}

Immunofluorescence - FOXM1 Rabbit pAb (A2493)

Immunofluorescence analysis of paraffin-embedded Mouse colon tissue using FOXM1 Rabbit pAb(A2493) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
ABclonal:Chromatin Immunoprecipitation - FOXM1 Rabbit pAb (A2493)}

Chromatin Immunoprecipitation - FOXM1 Rabbit pAb (A2493)

Chromatin immunoprecipitation analysis of extracts of 293T cells, using FOXM1 antibody (A2493) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Submit an review for A2493

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2493 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FOXM1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FOXM1. (Distance between topics and target gene indicate popularity.) FOXM1

* Data provided by citexs.com, for reference only.

Publishing research using A2493? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order