Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

EWSR1 Rabbit pAb (A13978)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Immunofluorescence - EWSR1 Rabbit pAb (A13978)

Immunofluorescence analysis of U2OS cells using EWSR1 antibody (A13978).

You may also interested in:

Overview

Product name EWSR1 Rabbit pAb
Catalog No. A13978
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human EWSR1 (NP_001156757.1).
Sequence MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNR
Gene ID 2130
Swiss prot Q01844
Synonyms EWS; EWS-FLI1; bK984G1.4; EWSR1
Calculated MW 68kDa
Observed MW

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Immunofluorescence    
Positive samples
Cellular location Cell membrane, Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

EWSR1 Rabbit pAb images

ABclonal:Immunofluorescence - EWSR1 Rabbit pAb (A13978)}

Immunofluorescence - EWSR1 Rabbit pAb (A13978)

Immunofluorescence analysis of U2OS cells using EWSR1 antibody (A13978).

Inquire About This Product

Submit your question about A13978 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EWSR1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EWSR1. (Distance between topics and target gene indicate popularity.) EWSR1

* Data provided by citexs.com, for reference only.

Publishing research using A13978? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order