Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

EP300 Rabbit pAb (A13016)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunohistochemistry - EP300 Rabbit pAb (A13016)

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using EP300 Rabbit pAb (A13016) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - EP300 Rabbit pAb (A13016)

Immunohistochemistry analysis of paraffin-embedded human placenta using EP300 Rabbit pAb (A13016) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - EP300 Rabbit pAb (A13016)

Immunohistochemistry analysis of paraffin-embedded mouse brain using EP300 Rabbit pAb (A13016) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - EP300 Rabbit pAb (A13016)

Immunohistochemistry analysis of paraffin-embedded rat kidney using EP300 Rabbit pAb (A13016) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - EP300 Rabbit pAb (A13016)

Immunofluorescence analysis of U2OS cells using EP300 Rabbit pAb (A13016) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name EP300 Rabbit pAb
Catalog No. A13016
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. This gene has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Defects in this gene are a cause of Rubinstein-Taybi syndrome and may also play a role in epithelial cancer.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human EP300 (NP_001420.2).
Sequence MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGL
Gene ID 2033
Swiss prot Q09472
Synonyms p300; KAT3B; MKHK2; RSTS2; EP300
Calculated MW 264kDa
Observed MW Refer to figures

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Immunohistochemistry    Immunofluorescence    
Positive samples
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Rattus norvegicus, Bos taurus)

CHIP (Homo sapiens)

Co-IP (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

EP300 Rabbit pAb images

ABclonal:Immunohistochemistry - EP300 Rabbit pAb (A13016)}

Immunohistochemistry - EP300 Rabbit pAb (A13016)

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using EP300 Rabbit pAb (A13016) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - EP300 Rabbit pAb (A13016)}

Immunohistochemistry - EP300 Rabbit pAb (A13016)

Immunohistochemistry analysis of paraffin-embedded human placenta using EP300 Rabbit pAb (A13016) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - EP300 Rabbit pAb (A13016)}

Immunohistochemistry - EP300 Rabbit pAb (A13016)

Immunohistochemistry analysis of paraffin-embedded mouse brain using EP300 Rabbit pAb (A13016) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - EP300 Rabbit pAb (A13016)}

Immunohistochemistry - EP300 Rabbit pAb (A13016)

Immunohistochemistry analysis of paraffin-embedded rat kidney using EP300 Rabbit pAb (A13016) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - EP300 Rabbit pAb (A13016)}

Immunofluorescence - EP300 Rabbit pAb (A13016)

Immunofluorescence analysis of U2OS cells using EP300 Rabbit pAb (A13016) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A13016 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EP300. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EP300. (Distance between topics and target gene indicate popularity.) EP300

* Data provided by citexs.com, for reference only.

Publishing research using A13016? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order