Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

eNOS Rabbit pAb (A15075)

Publications (8) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - eNOS Rabbit pAb (A15075)

Western blot analysis of lysates from 293T cells, using eNOS Rabbit pAb (A15075) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Western blot - eNOS Rabbit pAb (A15075)

Western blot analysis of lysates from Mouse liver, using eNOS Rabbit pAb (A15075) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - eNOS Rabbit pAb (A15075)

Immunohistochemistry analysis of eNOS in paraffin-embedded rat brain using eNOS Rabbit pAb (A15075) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - eNOS Rabbit pAb (A15075)

Immunofluorescence analysis of HUVEC cells using eNOS Rabbit pAb (A15075) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name eNOS Rabbit pAb
Catalog No. A15075
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. Nitric oxide is synthesized from L-arginine by nitric oxide synthases. Variations in this gene are associated with susceptibility to coronary spasm. Alternative splicing and the use of alternative promoters results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 639-738 of human eNOS (NP_000594.2).
Sequence AGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAARDIFSPKRSWKRQRYRLS
Gene ID 4846
Swiss prot P29474
Synonyms eNOS; ECNOS
Calculated MW 133kDa
Observed MW 140kDa/160kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293T, Mouse liver
Cellular location Cell membrane, Cytoplasm, Golgi apparatus, Membrane, caveola, cytoskeleton
Customer validation

WB (Homo sapiens, Mus musculus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

eNOS Rabbit pAb images

ABclonal:Western blot - eNOS Rabbit pAb (A15075)}

Western blot - eNOS Rabbit pAb (A15075)

Western blot analysis of lysates from 293T cells, using eNOS Rabbit pAb (A15075) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Western blot - eNOS Rabbit pAb (A15075)}

Western blot - eNOS Rabbit pAb (A15075)

Western blot analysis of lysates from Mouse liver, using eNOS Rabbit pAb (A15075) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Immunohistochemistry - eNOS Rabbit pAb (A15075)}

Immunohistochemistry - eNOS Rabbit pAb (A15075)

Immunohistochemistry analysis of eNOS in paraffin-embedded rat brain using eNOS Rabbit pAb (A15075) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - eNOS Rabbit pAb (A15075)}

Immunofluorescence - eNOS Rabbit pAb (A15075)

Immunofluorescence analysis of HUVEC cells using eNOS Rabbit pAb (A15075) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15075 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NOS3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NOS3. (Distance between topics and target gene indicate popularity.) NOS3

* Data provided by citexs.com, for reference only.

Publishing research using A15075? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order