Publications (34) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | α-Smooth Muscle Actin (ACTA2) Rabbit pAb |
---|---|
Catalog No. | A7248 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human α-Smooth Muscle Actin (ACTA2) (NP_001604.1). |
---|---|
Sequence | MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAP |
Gene ID | 59 |
Swiss prot | P62736 |
Synonyms | ACTSA; α-Smooth Muscle Actin (ACTA2) |
Calculated MW | 42kDa |
Observed MW | 42kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse heart |
Cellular location | Cytoplasm, cytoskeleton |
Customer validation | WB (Mus musculus, Homo sapiens, Zea mays, Rattus norvegicus) IF (Mus musculus, Rattus norvegicus, Homo sapiens) IHC (Mus musculus, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A7248 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on ACTA2. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to ACTA2. (Distance between topics and target gene indicate popularity.) ACTA2
* Data provided by citexs.com, for reference only.
Publishing research using A7248? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.