Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ZSCAN4C Rabbit pAb (A10205)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse

ABclonal:Western blot - ZSCAN4C Rabbit pAb (A10205)

Western blot analysis of extracts of mouse kidney, using ZSCAN4 antibody (A10205) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name ZSCAN4C Rabbit pAb
Catalog No. A10205
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Acts upstream of or within negative regulation of mitotic recombination; regulation of transcription by RNA polymerase II; and telomere maintenance via telomere lengthening. Located in chromosome, telomeric region; cytoplasm; and nucleus. Is expressed in 1-cell stage embryo; 2-cell stage embryo; primary oocyte; and secondary oocyte. Orthologous to human ZSCAN4 (zinc finger and SCAN domain containing 4).

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-506 of mouse ZSCAN4 (NP_001013787.1).
Sequence CSRMFKHARSLSSHQRTHLNKKSELLCVTCQKMFKRVSDRRTHEIIHMPEKPFKCSTCEKSFSHKTNLKSHEMIHTGEMPYVCSLCSRRFRQSSTYHRHLRNYHRSD
Gene ID 245109
Swiss prot
Synonyms Gm397; Zscan4d; XM_142517; ZSCAN4C
Calculated MW 57kDa
Observed MW 57kDa

Applications

Reactivity Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse kidney
Cellular location Chromosome, Nucleus, telomere

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

ZSCAN4C Rabbit pAb images

ABclonal:Western blot - ZSCAN4C Rabbit pAb (A10205)}

Western blot - ZSCAN4C Rabbit pAb (A10205)

Western blot analysis of extracts of mouse kidney, using ZSCAN4 antibody (A10205) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A10205 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Zscan4c. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Zscan4c. (Distance between topics and target gene indicate popularity.) Zscan4c

* Data provided by citexs.com, for reference only.

Publishing research using A10205? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order