Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ZNRF3 Rabbit pAb (A16026)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ZNRF3 Rabbit pAb (A16026)

Western blot analysis of lysates from Mouse testis, using ZNRF3 Rabbit pAb (A16026) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - ZNRF3 Rabbit pAb (A16026)

Immunohistochemistry analysis of ZNRF3 in paraffin-embedded human liver using ZNRF3 Rabbit pAb (A16026) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ZNRF3 Rabbit pAb (A16026)

Immunohistochemistry analysis of ZNRF3 in paraffin-embedded mouse spleen using ZNRF3 Rabbit pAb (A16026) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ZNRF3 Rabbit pAb (A16026)

Immunohistochemistry analysis of ZNRF3 in paraffin-embedded rat lung using ZNRF3 Rabbit pAb (A16026) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name ZNRF3 Rabbit pAb
Catalog No. A16026
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables frizzled binding activity and ubiquitin-protein transferase activity. Involved in cellular protein metabolic process and negative regulation of Wnt signaling pathway. Is integral component of plasma membrane.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ZNRF3 (NP_001193927.1).
Sequence QMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKV
Gene ID 84133
Swiss prot Q9ULT6
Synonyms RNF203; BK747E2.3; ZNRF3
Calculated MW 101kDa
Observed MW 101kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse testis
Cellular location plasma membrane
Customer validation

WB (Homo sapiens)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

ZNRF3 Rabbit pAb images

ABclonal:Western blot - ZNRF3 Rabbit pAb (A16026)}

Western blot - ZNRF3 Rabbit pAb (A16026)

Western blot analysis of lysates from Mouse testis, using ZNRF3 Rabbit pAb (A16026) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - ZNRF3 Rabbit pAb (A16026)}

Immunohistochemistry - ZNRF3 Rabbit pAb (A16026)

Immunohistochemistry analysis of ZNRF3 in paraffin-embedded human liver using ZNRF3 Rabbit pAb (A16026) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ZNRF3 Rabbit pAb (A16026)}

Immunohistochemistry - ZNRF3 Rabbit pAb (A16026)

Immunohistochemistry analysis of ZNRF3 in paraffin-embedded mouse spleen using ZNRF3 Rabbit pAb (A16026) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ZNRF3 Rabbit pAb (A16026)}

Immunohistochemistry - ZNRF3 Rabbit pAb (A16026)

Immunohistochemistry analysis of ZNRF3 in paraffin-embedded rat lung using ZNRF3 Rabbit pAb (A16026) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A16026 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZNRF3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ZNRF3. (Distance between topics and target gene indicate popularity.) ZNRF3

* Data provided by citexs.com, for reference only.

Publishing research using A16026? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order