Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ZEB1 Rabbit pAb (A5600)

Publications (15) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunohistochemistry - ZEB1 Rabbit pAb (A5600)

Immunohistochemistry analysis of ZEB1 in paraffin-embedded human mammary cancer using ZEB1 Rabbit pAb (A5600) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ZEB1 Rabbit pAb (A5600)

Immunohistochemistry analysis of ZEB1 in paraffin-embedded rat testis using ZEB1 Rabbit pAb (A5600) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ZEB1 Rabbit pAb (A5600)

Immunohistochemistry analysis of ZEB1 in paraffin-embedded mouse testis using ZEB1 Rabbit pAb (A5600) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ZEB1 Rabbit pAb (A5600)

Immunofluorescence analysis of C6 cells using ZEB1 Rabbit pAb (A5600) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ZEB1 Rabbit pAb
Catalog No. A5600
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-900 of human ZEB1 (NP_110378.3).
Sequence INIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
Gene ID 6935
Swiss prot P37275
Synonyms BZP; TCF8; AREB6; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1; ZEB1
Calculated MW 124kDa
Observed MW 200kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HT-1080, Jurkat
Cellular location Nucleus
Customer validation

WB (Homo sapiens, Mus musculus)

IF (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ZEB1 Rabbit pAb images

ABclonal:Immunohistochemistry - ZEB1 Rabbit pAb (A5600)}

Immunohistochemistry - ZEB1 Rabbit pAb (A5600)

Immunohistochemistry analysis of ZEB1 in paraffin-embedded human mammary cancer using ZEB1 Rabbit pAb (A5600) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ZEB1 Rabbit pAb (A5600)}

Immunohistochemistry - ZEB1 Rabbit pAb (A5600)

Immunohistochemistry analysis of ZEB1 in paraffin-embedded rat testis using ZEB1 Rabbit pAb (A5600) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ZEB1 Rabbit pAb (A5600)}

Immunohistochemistry - ZEB1 Rabbit pAb (A5600)

Immunohistochemistry analysis of ZEB1 in paraffin-embedded mouse testis using ZEB1 Rabbit pAb (A5600) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - ZEB1 Rabbit pAb (A5600)}

Immunofluorescence - ZEB1 Rabbit pAb (A5600)

Immunofluorescence analysis of C6 cells using ZEB1 Rabbit pAb (A5600) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A5600 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZEB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ZEB1. (Distance between topics and target gene indicate popularity.) ZEB1

* Data provided by citexs.com, for reference only.

Publishing research using A5600? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order